PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400053969 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 136aa MW: 15019.8 Da PI: 5.2229 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 106.9 | 1.3e-33 | 1 | 80 | 17 | 96 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 m+k+lP +akis+ +k ++qecvsefi+f+t+ea+d cqr++r+ti+++d+l a+ +Gf+dyv +l +yl++yre +g PGSC0003DMP400053969 1 MHKILPPHAKISDGSKLITQECVSEFIGFITGEANDCCQRDQRNTITAEDVLCAMDRFGFDDYVGTLALYLHRYREYDGG 80 89**************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.7E-30 | 1 | 86 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-12 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 4.02E-24 | 1 | 84 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 7.9E-9 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 7.9E-9 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 7.9E-9 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MHKILPPHAK ISDGSKLITQ ECVSEFIGFI TGEANDCCQR DQRNTITAED VLCAMDRFGF 60 DDYVGTLALY LHRYREYDGG RGSTRREPLL LRRSMVNPAS VYSITPYQGD ASNGNTSQGD 120 AVDIKVESPV KEAKE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-35 | 1 | 76 | 22 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400053969 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975444 | 1e-155 | HG975444.1 Solanum pennellii chromosome ch05, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006365238.1 | 2e-98 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 2e-35 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | M1D230 | 4e-97 | M1D230_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400079574 | 7e-98 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 3e-38 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400053969 |