PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400048897 | ||||||||
Common Name | LOC102587642 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 177aa MW: 19849.5 Da PI: 10.5116 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 80.2 | 3.5e-25 | 30 | 85 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 ++p++VNaKQy++Il+RR+ Rak e+ +l k rkp+lh SRh hA+ RpRg gGrF PGSC0003DMP400048897 30 ESPIFVNAKQYHGILRRRKFRAKEMEK-NL-LKPRKPFLHLSRHLHAKSRPRGGGGRF 85 58********************97764.45.6*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 9.3E-26 | 28 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 28.679 | 29 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 8.3E-19 | 32 | 54 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.8E-21 | 32 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 8.3E-19 | 62 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MDYQGHFDLG LFGQSLGRIM LPLNLTSHDE SPIFVNAKQY HGILRRRKFR AKEMEKNLLK 60 PRKPFLHLSR HLHAKSRPRG GGGRFLNTRK TNGSINDDAN GTTKTSNKKC HHTISQNSEV 120 LQSDVFNFNS TKETTNNMSS IEAFLDTTNT GHDILMASKW GSAAAVDSYC CRNLKI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-14 | 30 | 98 | 2 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
4g91_A | 9e-15 | 30 | 88 | 2 | 62 | HAPB protein |
4g92_A | 9e-15 | 30 | 88 | 2 | 62 | HAPB protein |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400048897 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975449 | 1e-144 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006339173.1 | 1e-131 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1 | ||||
Refseq | XP_015165468.1 | 1e-131 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1 | ||||
Refseq | XP_015165472.1 | 1e-131 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2 | ||||
Refseq | XP_015165474.1 | 1e-131 | PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2 | ||||
TrEMBL | M1CQ29 | 1e-129 | M1CQ29_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400072322 | 1e-130 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06510.3 | 3e-34 | nuclear factor Y, subunit A10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400048897 |
Entrez Gene | 102587642 |
Publications ? help Back to Top | |||
---|---|---|---|
|