PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047194
Common NameLOC102606117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 325aa    MW: 37488.5 Da    PI: 6.5809
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047194genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-174188148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT eEd  l++ ++ +G g+W++ +r+ g++Rt+k+c++rw++yl
  PGSC0003DMP400047194 41 RGPWTVEEDFTLINFIAHHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 88
                          89********************************************97 PP

2Myb_DNA-binding51.32.8e-1694137146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  PGSC0003DMP400047194  94 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 137
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6083688IPR017930Myb domain
SuperFamilySSF466892.55E-3038135IPR009057Homeodomain-like
SMARTSM007171.2E-144090IPR001005SANT/Myb domain
PfamPF002491.3E-154188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-214295IPR009057Homeodomain-like
CDDcd001673.85E-114388No hitNo description
PROSITE profilePS5129423.24689143IPR017930Myb domain
SMARTSM007171.3E-1493141IPR001005SANT/Myb domain
PfamPF002495.5E-1594137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2396142IPR009057Homeodomain-like
CDDcd001673.51E-7114137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEYHGQKIEV DSGRGREGGR GDCNENNQEI KEEDVVMELR RGPWTVEEDF TLINFIAHHG  60
EGRWNSLSRC AGLKRTGKSC RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA  120
QHLPGRTDNE IKNYWRTRVQ KHAKQLKCDV NSKQFKDTMK YLWMPRLAER IQATAAATSN  180
PTAASSSGPT ATTTYIQNQE IQHPLPNMNH HVPEYLPIQL MNIEKTNSLN YSATSASSDN  240
YSSDLTDGCY NFPINQSNNQ DHSQVNQSTN QFCYGESTIN PTSYNFHPGF QGFQEVDQQN  300
NTQWMENPWN IEDVCFLQQL NNDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-2438135197MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-233813555151MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-233813555151MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-243813524120MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400047194
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355725.10.0PREDICTED: transcription factor MYB108
SwissprotQ2QZJ81e-89JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBLM1CL870.0M1CL87_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000698410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-83myb domain protein 78
Publications ? help Back to Top
  1. Ahn IP,Kim S,Kang S,Suh SC,Lee YH
    Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct.
    Phytopathology, 2005. 95(11): p. 1248-55
    [PMID:18943354]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Campos-Soriano L,García-Martínez J,San Segundo B
    The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection.
    Mol. Plant Pathol., 2012. 13(6): p. 579-92
    [PMID:22212404]
  4. Yokotani N, et al.
    Role of the rice transcription factor JAmyb in abiotic stress response.
    J. Plant Res., 2013. 126(1): p. 131-9
    [PMID:22847900]
  5. Wang D, et al.
    Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response.
    Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007
    [PMID:26740780]
  6. Fred AK,Kiswara G,Yi G,Kim KM
    Screening Rice Cultivars for Resistance to Bacterial Leaf Blight.
    J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45
    [PMID:26869604]