PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400045040
Common NameLOC102606202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 769aa    MW: 83211 Da    PI: 5.9505
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400045040genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.43e-1044087672374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           +++L+++Ae v++g+  laq +Larl+++ sp g+p+ R+a+y +eAL+  l+ ++++l  ++++s+ s    + ++ a+k fse+sP+
  PGSC0003DMP400045040 408 IDQLFKAAELVQTGNPVLAQGILARLNHQLSPIGKPFYRAAFYCKEALQLLLHANTNNLNPSMASSPFS---LIFKIGAYKSFSEISPV 493
                           689***************************************************999999888888888...***************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                            +f+++t+Nqa+le ++g er+Hi+Dfdi++G+QW++L+q+La R++g+p+l+iT+++sp+++++ el  t+e+L +fA+e+++ fef+
  PGSC0003DMP400045040 494 AQFANFTCNQALLEVLDGFERIHIVDFDIGYGGQWASLMQELALRSGGAPTLKITALASPSTHDQLELGLTRENLIHFASEINMAFEFE 582
                           ***************************************************************************************** PP

                  GRAS 180 vlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           +l  ++l++   ++L   v+++Ea+aVnl ++  + +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F +++++al+ ys 
  PGSC0003DMP400045040 583 ILSIDSLNST-SWSLppLVSENEAIAVNLPVSSLSSY--QLSLPL----VLRFVKQLSPRIVVSVDRGCDRTDLPFPNHVIQALQSYSN 664
                           *977766665.4555334788**********877776..555555....**************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           l++sl+a    + ++ +k+Er+ll++ i+ +v+ + ++     e+ ++Wr+ + ++GF+p++ls+++++qa++++++++++g++ve+++
  PGSC0003DMP400045040 665 LLESLDAV-NVNFDALQKIERFLLQPGIERIVMGRFRS----PEKTQHWRSLFLSSGFSPLSLSNFTESQAECVVKRTPVRGFHVEKRQ 748
                           *****665.3466999****************998877....9********************************************** PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                            slvl+W++++L+s+SaWr
  PGSC0003DMP400045040 749 SSLVLCWQRKELISASAWR 767
                           ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.482381747IPR005202Transcription factor GRAS
PfamPF035141.1E-101408767IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MKGMPLPFEF EGKGVLELDV LFNKNSILNS WNNHNSSKES SSCCYFVNSP SAVLDTIRSP  60
RPINSSSTLS SSLGGGGGGG GGTASTDTAG GGGVAAVSAN PSSKWQQQDN TTATSSNVGA  120
ESELQQVQPP SSLEMGAASA AAATGGEKCA MEEWEGGLSE SVMASPCQEQ SILRWIMGDV  180
DDPSMANLNK VLQVSGTGDY EFNGGFGVVD QGFGVDPVGQ IGSFMPAISS SSSFPTNRMS  240
SDKIGLVSNP PTNLPQNPIF PSLSNNLGPI AFGQTQQQPF ESTDLKPHSF NSQFLINQHQ  300
TQIPQNPSFL LPLPFAQHEQ NLVLPPQAKR HNPGTMGGLE PGSQISKGLF LDAGHQQPTP  360
SQGLAHQLQL LPHFRPGAMG TKPKMVGEEM GQFHQLQQQQ QQQQQAIIDQ LFKAAELVQT  420
GNPVLAQGIL ARLNHQLSPI GKPFYRAAFY CKEALQLLLH ANTNNLNPSM ASSPFSLIFK  480
IGAYKSFSEI SPVAQFANFT CNQALLEVLD GFERIHIVDF DIGYGGQWAS LMQELALRSG  540
GAPTLKITAL ASPSTHDQLE LGLTRENLIH FASEINMAFE FEILSIDSLN STSWSLPPLV  600
SENEAIAVNL PVSSLSSYQL SLPLVLRFVK QLSPRIVVSV DRGCDRTDLP FPNHVIQALQ  660
SYSNLLESLD AVNVNFDALQ KIERFLLQPG IERIVMGRFR SPEKTQHWRS LFLSSGFSPL  720
SLSNFTESQA ECVVKRTPVR GFHVEKRQSS LVLCWQRKEL ISASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-354077674375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400045040
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347894.10.0PREDICTED: scarecrow-like protein 22
TrEMBLM1CG750.0M1CG75_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-137GRAS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]