PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400044381 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 172aa MW: 19751.2 Da PI: 5.8743 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 57.3 | 2.6e-18 | 31 | 84 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ eq+++Le+ Fe +++ e++ +LA+ lgL+ rq+ +WFqNrRa++k PGSC0003DMP400044381 31 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 84 456899***********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 132.9 | 1.2e-42 | 30 | 121 | 1 | 92 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 ekkrrl+ eqvk+LE++Fe +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lkr++da+k+en++L++++++L++ PGSC0003DMP400044381 30 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKRQFDAIKAENDALQTQNQKLHA 118 69**************************************************************************************9 PP HD-ZIP_I/II 90 elk 92 e++ PGSC0003DMP400044381 119 EVR 121 986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-19 | 8 | 87 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.84E-20 | 22 | 88 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.329 | 26 | 86 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.8E-17 | 29 | 90 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.04E-15 | 31 | 87 | No hit | No description |
Pfam | PF00046 | 1.1E-15 | 31 | 84 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 5.1E-6 | 57 | 66 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 61 | 84 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 5.1E-6 | 66 | 82 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 2.9E-16 | 86 | 123 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009744 | Biological Process | response to sucrose | ||||
GO:0048826 | Biological Process | cotyledon morphogenesis | ||||
GO:0080022 | Biological Process | primary root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MSFSGMDGNN ACEENHGEDD LSDDGSQAGE KKRRLNMEQV KTLEKNFELG NKLEPERKMQ 60 LARALGLQPR QIAIWFQNRR ARWKTKQLEK DYEVLKRQFD AIKAENDALQ TQNQKLHAEV 120 RCLGWGSNRG WVLNLDLGDE ARSRLDLRSW DWDLGLGLGL GFVEYVFSIP L* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 78 | 86 | RRARWKTKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00225 | DAP | Transfer from AT1G69780 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400044381 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC139840 | 0.0 | AC139840.1 Solanum demissum chromosome 5 clone PGEC323D8, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006363243.1 | 2e-81 | PREDICTED: homeobox-leucine zipper protein ATHB-13-like | ||||
Swissprot | Q8LC03 | 3e-61 | ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13 | ||||
TrEMBL | M1CEL0 | 1e-121 | M1CEL0_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400065805 | 8e-81 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69780.1 | 3e-63 | HD-ZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400044381 |
Publications ? help Back to Top | |||
---|---|---|---|
|