PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400044274 | ||||||||
Common Name | LOC102605234 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 233aa MW: 27065.8 Da PI: 9.6268 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98 | 4e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyeys+ PGSC0003DMP400044274 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSN 59 79***********************************************95 PP | |||||||
2 | K-box | 96.8 | 3.3e-32 | 79 | 173 | 6 | 100 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 ++e +a+ +qqe++kL+++i+ +q+++Rhl+Ge+L sL+++eL+qLe++Le+++++iRskK+e +l+++e+l k+e +l++en L PGSC0003DMP400044274 79 AYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLNVRELKQLENRLERGITRIRSKKHEAILAETENLHKREIQLEQENAFL 167 33478999********************************************************************************* PP K-box 95 rkklee 100 r+k++e PGSC0003DMP400044274 168 RSKIAE 173 ***986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.852 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.07E-43 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 5.62E-33 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.4E-25 | 83 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.408 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFST RGRLYEYSNN 60 NVKATIERYK KATAETSSAY TTQELNAQFY QQESKKLRQQ IQLMQNTNRH LVGEGLCSLN 120 VRELKQLENR LERGITRIRS KKHEAILAET ENLHKREIQL EQENAFLRSK IAENERLQEL 180 SMMPSGEQGG EEYNAFQQYL ARNMLQLNMM ETAVPSYDPL SPDHKRSHLQ LQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400044274 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY098736 | 0.0 | AY098736.2 Lycopersicon esculentum TAGL11 transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006339358.1 | 1e-170 | PREDICTED: agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-108 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | M1CEC2 | 1e-169 | M1CEC2_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400065614 | 1e-170 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 4e-97 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400044274 |
Entrez Gene | 102605234 |