PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400042874 | ||||||||
Common Name | LOC102604033 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 139aa MW: 15994 Da PI: 4.6543 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 150.2 | 4.2e-47 | 3 | 96 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 eq +++Pianv+rimk++lP akisk+aket+qec+sefisfvt+easdkcq+e+r+t+ngdd++wal++lGf++y+e + yl k r+ PGSC0003DMP400042874 3 DEQVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCQKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRD 93 58899************************************************************************************** PP NF-YB 93 leg 95 +e+ PGSC0003DMP400042874 94 FER 96 *98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-44 | 2 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.0E-26 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 9.83E-35 | 9 | 124 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.1E-16 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.1E-16 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 1.1E-16 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MVDEQVKLVP IANVGRIMKQ ILPPTAKISK EAKETMQECA SEFISFVTGE ASDKCQKENR 60 RTVNGDDICW ALSSLGFDNY AEVMLRYLYK LRDFERVRAN QNKLGLNEDD EDNRDDEEAP 120 SAPLEFNIME RVQRRRFN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-37 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-37 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400042874 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-152 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006344838.1 | 6e-99 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-49 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | M1CB00 | 1e-97 | M1CB00_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400063671 | 2e-98 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-51 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400042874 |
Entrez Gene | 102604033 |
Publications ? help Back to Top | |||
---|---|---|---|
|