PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400042628 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 177aa MW: 20499.4 Da PI: 10.178 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95 | 3.5e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+eys+ PGSC0003DMP400042628 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 99.5 | 5e-33 | 79 | 173 | 5 | 98 |
K-box 5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 + ++ ++ ++ s++ e+akLk+++e Lqr+q+h+ Ge+L++Ls+ke q+Le+qL+++lk+iRs+Kn+l++e+i+ lqkk k+lqe+n+ PGSC0003DMP400042628 79 QLNAaTDIETPGSWTLEHAKLKARLEVLQRNQKHYAGEELNTLSMKEFQNLEHQLDSALKHIRSRKNQLMHESISALQKKDKALQEQNN 167 5555455667789**************************************************************************** PP K-box 93 aLrkkl 98 +L+k++ PGSC0003DMP400042628 168 NLSKQV 173 ***997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.9E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.184 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-33 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.74E-40 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 2.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 14.748 | 89 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.1E-27 | 91 | 173 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYSTD 60 SCMERILERY ERYSYAERQL NAATDIETPG SWTLEHAKLK ARLEVLQRNQ KHYAGEELNT 120 LSMKEFQNLE HQLDSALKHI RSRKNQLMHE SISALQKKDK ALQEQNNNLS KQVINN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400042628 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT014057 | 0.0 | BT014057.1 Lycopersicon esculentum clone 133155F, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006345101.1 | 1e-124 | PREDICTED: agamous-like MADS-box protein AGL8 homolog | ||||
Swissprot | Q42429 | 1e-108 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | M1CAG5 | 1e-126 | M1CAG5_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400063313 | 1e-124 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 3e-94 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400042628 |
Publications ? help Back to Top | |||
---|---|---|---|
|