PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400042586 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 142aa MW: 15497 Da PI: 4.9504 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 58.7 | 1.4e-18 | 11 | 81 | 3 | 73 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73 ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al PGSC0003DMP400042586 11 KEDASLPKATMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKALEV 81 6899**************************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.6E-27 | 8 | 82 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.86E-24 | 12 | 81 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-20 | 14 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MEPMDIVGKT KEDASLPKAT MTKIIKEMLP PDVRVARDTQ DLLIECCVEF INLISSESNE 60 VCNREDKRTI APEHVLKALE VLLDPGVALL CSSSSSCSFC NSLLFSAAVT ISMSSFEGDL 120 KNFKPSSHLR SQSGMVPIRM M* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 4e-23 | 12 | 82 | 12 | 81 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400042586 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975515 | 1e-136 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006345063.1 | 9e-53 | PREDICTED: protein Dr1 homolog | ||||
Swissprot | P49592 | 2e-50 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | M1CAC4 | 3e-97 | M1CAC4_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400063256 | 3e-52 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08190.1 | 8e-53 | nuclear factor Y, subunit B12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400042586 |
Publications ? help Back to Top | |||
---|---|---|---|
|