PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040666
Common NameLOC102582848
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 189aa    MW: 21509.8 Da    PI: 5.5758
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040666genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73e-09346344
                          SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
       Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                           WT ++d+l+ ++  +++ +   +W +Ia +++ g+t+ ++  ++
  PGSC0003DMP400040666  3 TWTRDDDKLFEHGLVLYPENvadRWQLIADHVP-GKTADDIMAHY 46
                          7********************************.********999 PP

2Myb_DNA-binding41.62.8e-1397141347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT++E+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  PGSC0003DMP400040666  97 PWTEDEHRLFLIGLDKYGKGDWRSISRNVVVSRTPTQVASHAQKY 141
                           8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.2E-5152IPR001005SANT/Myb domain
PROSITE profilePS5129310.365148IPR017884SANT domain
SuperFamilySSF466894.69E-11258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-5348IPR009057Homeodomain-like
CDDcd001679.77E-9346No hitNo description
PfamPF002497.9E-8347IPR001005SANT/Myb domain
PROSITE profilePS5129421.68490146IPR017930Myb domain
SuperFamilySSF466891.38E-1692146IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-1793145IPR006447Myb domain, plants
SMARTSM007172.3E-1094144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-1194140IPR009057Homeodomain-like
CDDcd001672.95E-997142No hitNo description
PfamPF002494.1E-1197141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSTWTRDDDK LFEHGLVLYP ENVADRWQLI ADHVPGKTAD DIMAHYDDLV HDVFEIDSGR  60
IDLPSYTDDP VELEGDCQIS SGSNKKNNEI ERKKGTPWTE DEHRLFLIGL DKYGKGDWRS  120
ISRNVVVSRT PTQVASHAQK YFIRQQAMKK ERKRSSIHDI TTAVDTNPVP PQSSFQNQSG  180
SQNFNFAM*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400040666
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2433390.0AJ243339.1 Lycopersicon esculentum mRNA for I-box binding factor (LeMYBI gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345871.11e-140PREDICTED: transcription factor DIVARICATA-like
SwissprotQ9FNN63e-56SRM1_ARATH; Transcription factor SRM1
TrEMBLM1C5T11e-139M1C5T1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000604031e-140(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-72MYB family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  3. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]