PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400039764 | ||||||||
Common Name | LOC102577630, WHY2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 111aa MW: 12274.8 Da PI: 7.7037 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 101.2 | 1e-31 | 1 | 72 | 68 | 139 |
Whirly 68 laskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 +++++s+effhdp++ +sn+G+vrk+l+++P +dGsG+f++lsv n+ +k+n++f+vPv+ aefav+r++++ PGSC0003DMP400039764 1 MGTRDSSEFFHDPSMLSSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFS 72 89*******************************************************************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF54447 | 2.51E-31 | 1 | 108 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 2.5E-35 | 1 | 91 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 3.2E-26 | 1 | 70 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MGTRDSSEFF HDPSMLSSNA GQVRKSLSIK PNADGSGYFI SLSVVNNNLK TNDRFTVPVT 60 TAEFAVMRTA FSFALPHIMG WDRFTNRPSE SISQSPSKVV PQLMEAEWDR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 3e-60 | 1 | 90 | 83 | 172 | StWhy2 |
3n1i_A | 3e-60 | 1 | 90 | 83 | 172 | protein StWhy2 |
3n1j_A | 3e-60 | 1 | 90 | 83 | 172 | Protein StWhy2 |
3n1k_A | 3e-60 | 1 | 90 | 83 | 172 | protein StWhy2 |
3n1l_A | 3e-60 | 1 | 90 | 83 | 172 | protein StWhy2 |
3r9y_A | 3e-60 | 1 | 90 | 83 | 172 | Why2 protein |
3r9z_A | 3e-60 | 1 | 90 | 83 | 172 | Why2 protein |
3ra0_A | 3e-60 | 1 | 90 | 83 | 172 | Why2 protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400039764 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM234504 | 0.0 | HM234504.1 Solanum tuberosum Why2 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015166241.1 | 2e-75 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 | ||||
Swissprot | D9J034 | 2e-76 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A3Q7JMC9 | 1e-73 | A0A3Q7JMC9_SOLLC; Uncharacterized protein | ||||
TrEMBL | M1C3P3 | 1e-75 | M1C3P3_SOLTU; Uncharacterized protein | ||||
STRING | Solyc11g044750.1.1 | 1e-74 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 2e-51 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400039764 |
Entrez Gene | 102577630 |
Publications ? help Back to Top | |||
---|---|---|---|
|