PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039377
Common NameLOC102605596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 473aa    MW: 53223.9 Da    PI: 6.5127
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039377genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS465.82.5e-142484691374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lLl+cA++v+ g+le+a+ +L ++s+lasp+gd+mqR+a+yf+e La r++rs++++ykal++++ +   +se + + k+f+e +P
  PGSC0003DMP400039377  48 LIHLLLTCANHVAIGNLENANIALDQISHLASPNGDTMQRIASYFAESLADRILRSWNGIYKALNSTKLR--VVSEDILVKKMFFEYFP 134
                           689**************************************************************99998..69*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                           +lk++ ++aNqaI ea+ege++vHi+D+++s++lQW aLlq L++Rpegpp+lRiTgv++    +k+ le++++ L++ Ae+l++pf+f
  PGSC0003DMP400039377 135 FLKVASVIANQAIIEAMEGEKMVHIVDLNASEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKQVLEQIAHVLTEEAEKLDIPFQF 219
                           ************************************************************....9************************ PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrll..................................................... 214
                           +  v+++le+l++e+Lrvk+gEala+++v+qlh+ll                                                     
  PGSC0003DMP400039377 220 HQ-VVSKLENLDIEKLRVKTGEALAISSVMQLHTLLahddepqkksplgfkhlnglhlqrailnqntlgdlleketttnvfspgnesas 307
                           **.799*********************************************************************************88 PP

                  GRAS 215 ....desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                               ++++s+  + d +L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le +l r+s er kvE++l+g+ei+n+va
  PGSC0003DMP400039377 308 ssplSSTAST--KMDGFLHALWGLSPKVMVVTEQDSNHNGTTLMERLSESLYFYAALFDCLEFTLQRTSLERLKVEKMLFGEEIKNIVA 394
                           7654333333..4699************************************************************************* PP

                  GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           ceg er+erhe+l kW +r++ aGF +vpls++a+ qa++ll+ ++ +gy+++ee+gs+v++W+dr+L++vSaWr
  PGSC0003DMP400039377 395 CEGGERKERHEKLDKWFQRFDGAGFANVPLSYYAMLQARRLLQSYSCEGYKIKEENGSVVICWHDRALFAVSAWR 469
                           **************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.08322449IPR005202Transcription factor GRAS
PfamPF035148.6E-14048469IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPLQNFP MMSLSPNFGG SPYQWLKDLK SEDRGLYLIH LLLTCANHVA  60
IGNLENANIA LDQISHLASP NGDTMQRIAS YFAESLADRI LRSWNGIYKA LNSTKLRVVS  120
EDILVKKMFF EYFPFLKVAS VIANQAIIEA MEGEKMVHIV DLNASEPLQW RALLQDLSAR  180
PEGPPHLRIT GVHQQKQVLE QIAHVLTEEA EKLDIPFQFH QVVSKLENLD IEKLRVKTGE  240
ALAISSVMQL HTLLAHDDEP QKKSPLGFKH LNGLHLQRAI LNQNTLGDLL EKETTTNVFS  300
PGNESASSSP LSSTASTKMD GFLHALWGLS PKVMVVTEQD SNHNGTTLME RLSESLYFYA  360
ALFDCLEFTL QRTSLERLKV EKMLFGEEIK NIVACEGGER KERHEKLDKW FQRFDGAGFA  420
NVPLSYYAML QARRLLQSYS CEGYKIKEEN GSVVICWHDR ALFAVSAWRC RR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-40324712380Protein SCARECROW
5b3h_D2e-40324712380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400039377
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362746.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM1C2Q40.0M1C2Q4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000584770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  3. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  4. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]