PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400039325 | ||||||||
Common Name | LOC102604580 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 137aa MW: 14927.5 Da PI: 6.5213 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167.3 | 2e-52 | 21 | 116 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 reqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvtseasdkc++e+rkt+ngdd++wal+tlGf+dy +lk yl++y PGSC0003DMP400039325 21 REQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTSEASDKCRKERRKTVNGDDVCWALGTLGFDDYGGALKRYLHRY 109 89*************************************************************************************** PP NF-YB 91 relegek 97 re egek PGSC0003DMP400039325 110 RESEGEK 116 ****997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.9E-50 | 16 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.48E-38 | 23 | 130 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-26 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.0E-15 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 1.0E-15 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 1.0E-15 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MSQQNIGGAS SSNDEGAGSS REQDRLLPIA NVGRIMKNIL PPNAKISKEA KETMQECVSE 60 FIGFVTSEAS DKCRKERRKT VNGDDVCWAL GTLGFDDYGG ALKRYLHRYR ESEGEKVNQE 120 QAGGGSGSHQ PRNYLD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-44 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-44 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400039325 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 0.0 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
GenBank | HG975513 | 0.0 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006342784.1 | 3e-98 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 9e-59 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | M1C2L2 | 7e-97 | M1C2L2_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400058414 | 1e-97 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-61 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400039325 |
Entrez Gene | 102604580 |
Publications ? help Back to Top | |||
---|---|---|---|
|