PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400038360 | ||||||||
Common Name | LOC102584379 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 186aa MW: 20432.7 Da PI: 5.9489 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.9 | 1.1e-56 | 22 | 117 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 reqdrflPianvsrimkk+lPanakiskdake+vqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplk+yl+++ PGSC0003DMP400038360 22 REQDRFLPIANVSRIMKKALPANAKISKDAKEVVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYIEPLKIYLQRF 110 89*************************************************************************************** PP NF-YB 91 relegek 97 r+leg+k PGSC0003DMP400038360 111 RDLEGQK 117 ****986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.6E-54 | 18 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.94E-41 | 24 | 129 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.7E-28 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-20 | 55 | 73 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-20 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 1.2E-20 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MADSDNESGG HRENSNIESS LREQDRFLPI ANVSRIMKKA LPANAKISKD AKEVVQECVS 60 EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYI EPLKIYLQRF RDLEGQKSGI 120 SGEKDNGGSV NIGGYVEDYH GMMMMGNQHH QGHGYGTGVY NHQTGENAAG VGTGGSRFPD 180 VGRQR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 2e-47 | 20 | 112 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-47 | 20 | 112 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400038360 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT013228 | 0.0 | BT013228.1 Lycopersicon esculentum clone 134470F, mRNA sequence. | |||
GenBank | HG975519 | 0.0 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006346138.1 | 1e-137 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_015163652.1 | 1e-137 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 4e-71 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | M1C0B3 | 1e-136 | M1C0B3_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400057066 | 1e-136 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-73 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400038360 |
Entrez Gene | 102584379 |
Publications ? help Back to Top | |||
---|---|---|---|
|