PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400037408 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 149aa MW: 17368.7 Da PI: 9.2132 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174 | 4.4e-54 | 7 | 136 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkat 86 +ppGfrFhPtdeelv++yL+kk+++++++l +vik++d+yk+ePwdL++ ++ +ee+ +wyfFs++dkky+tg+r+nrat++g+Wkat PGSC0003DMP400037408 7 VPPGFRFHPTDEELVDYYLRKKITSRRIDL-DVIKDIDLYKIEPWDLQElcRMGTEEQsDWYFFSHKDKKYPTGTRTNRATAAGFWKAT 94 69****************************.9***************954555554445****************************** PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 g+dk+++s k+ l+g++ktLv+ykgrap+g+k+d +mheyrle PGSC0003DMP400037408 95 GRDKAIYS-KHDLIGMRKTLVYYKGRAPNGQKSDFIMHEYRLE 136 ********.8899****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-55 | 5 | 140 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.753 | 7 | 148 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.5E-28 | 8 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010981 | Biological Process | regulation of cell wall macromolecule metabolic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0045491 | Biological Process | xylan metabolic process | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:0090058 | Biological Process | metaxylem development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0009531 | Cellular Component | secondary cell wall | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MNSLSHVPPG FRFHPTDEEL VDYYLRKKIT SRRIDLDVIK DIDLYKIEPW DLQELCRMGT 60 EEQSDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVYYKGRA 120 PNGQKSDFIM HEYRLETDPN GAPQASFP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 9e-48 | 6 | 135 | 14 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400037408 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975518 | 1e-144 | HG975518.1 Solanum lycopersicum chromosome ch06, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015169148.1 | 1e-104 | PREDICTED: NAC domain-containing protein 7-like | ||||
Swissprot | Q9FWX2 | 7e-94 | NAC7_ARATH; NAC domain-containing protein 7 | ||||
TrEMBL | M1BY51 | 1e-108 | M1BY51_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400055552 | 1e-108 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA134 | 24 | 297 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G12260.1 | 9e-86 | NAC 007 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400037408 |
Publications ? help Back to Top | |||
---|---|---|---|
|