PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400036347 | ||||||||
Common Name | LOC102597276 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 70aa MW: 7598.25 Da PI: 10.7353 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 134.2 | 3.1e-42 | 3 | 69 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + ve+ G+nPGlivllv+ggl+l+fl+gny+lyvyaqk+lPP+kkkP+skkk+k+e+lkqGv++PGe PGSC0003DMP400036347 3 KDVEVNGFNPGLIVLLVIGGLVLTFLIGNYVLYVYAQKTLPPKKKKPISKKKMKKERLKQGVSAPGE 69 568***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 4.1E-40 | 5 | 69 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
MAKDVEVNGF NPGLIVLLVI GGLVLTFLIG NYVLYVYAQK TLPPKKKKPI SKKKMKKERL 60 KQGVSAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400036347 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254722 | 1e-106 | AC254722.3 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-53k5 map 10, complete sequence. | |||
GenBank | HG975522 | 1e-106 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004249690.1 | 2e-41 | DNA-binding protein S1FA | ||||
Refseq | XP_006361668.1 | 2e-41 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_015055951.1 | 2e-41 | DNA-binding protein S1FA-like | ||||
Refseq | XP_015055952.1 | 2e-41 | DNA-binding protein S1FA-like | ||||
Refseq | XP_016543084.1 | 2e-41 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_016543085.1 | 2e-41 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_019071702.1 | 2e-41 | DNA-binding protein S1FA | ||||
Swissprot | Q42337 | 3e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A2G2VTX6 | 7e-41 | A0A2G2VTX6_CAPBA; DNA-binding protein S1FA2 | ||||
STRING | PGSC0003DMT400045331 | 3e-40 | (Solanum tuberosum) |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400036347 |
Entrez Gene | 102597276 |
Publications ? help Back to Top | |||
---|---|---|---|
|