PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400028423 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 118aa MW: 13736.6 Da PI: 4.2909 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 78.6 | 1e-24 | 33 | 91 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+ye+++d++ ++++sws+ +nsf+v+d++++a + Lp+yFkh+nf+SFvRQLn+Y PGSC0003DMP400028423 33 FLTKTYELVDDPSSNDVVSWSRGNNSFIVWDPQNLAINFLPRYFKHNNFSSFVRQLNTY 91 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 3.6E-26 | 26 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 3.54E-23 | 28 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.5E-22 | 29 | 115 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-14 | 33 | 56 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 4.7E-20 | 33 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-14 | 71 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-14 | 84 | 96 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MDDFDNLIKE EFDGSFLVPQ PKECLHENGP PPFLTKTYEL VDDPSSNDVV SWSRGNNSFI 60 VWDPQNLAIN FLPRYFKHNN FSSFVRQLNT YVSIIFIFYL YMTTIHLLIC SILYDDV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d8k_B | 5e-17 | 31 | 91 | 3 | 63 | Heat shock factor protein 2 |
5d8l_B | 5e-17 | 31 | 91 | 3 | 63 | Heat shock factor protein 2 |
5d8l_D | 5e-17 | 31 | 91 | 3 | 63 | Heat shock factor protein 2 |
5d8l_F | 5e-17 | 31 | 91 | 3 | 63 | Heat shock factor protein 2 |
5d8l_H | 5e-17 | 31 | 91 | 3 | 63 | Heat shock factor protein 2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400028423 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975445 | 1e-153 | HG975445.1 Solanum pennellii chromosome ch06, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006350653.1 | 7e-62 | PREDICTED: heat stress transcription factor A-6b-like | ||||
Swissprot | Q9LUH8 | 5e-36 | HFA6B_ARATH; Heat stress transcription factor A-6b | ||||
TrEMBL | M1BC85 | 2e-80 | M1BC85_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400041944 | 3e-61 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 2e-38 | heat shock transcription factor A6B |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400028423 |
Publications ? help Back to Top | |||
---|---|---|---|
|