PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400027527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 589aa    MW: 64429.4 Da    PI: 4.7704
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400027527genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.51.6e-1391995741374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           lv++L++cAeav++++l+la++l+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+e++P
  PGSC0003DMP400027527 199 LVHTLMACAEAVQQENLTLADQLVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDSIESSYTDVLQM--HFYETCP 277
                           689****************************************************........44666654445555544..4****** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                           +lkf+h+taNqaIlea+ g+++vH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+fef
  PGSC0003DMP400027527 278 YLKFAHFTANQAILEAFTGCNKVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAETIGVEFEF 366
                           ***************************************************************************************** PP

                  GRAS 179 nvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           + +va++l+dl+   L+++p   Ea+a+n+v++lhrll++++++e+    vL+ +k+++Pk+v++veqea+hn++ F +rf eal+yys
  PGSC0003DMP400027527 367 RGFVANSLADLDAAILDIRPseTEAVAINSVFELHRLLSRPGAIEK----VLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYS 451
                           *******************99999**************99999999....*************************************** PP

                  GRAS 266 alfdsleak.............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                           ++fdsle++              p+ ++++ ++++++lgr+i+nvvaceg++r+erhetl++Wr r++++GF pv+l+++a kqa++ll
  PGSC0003DMP400027527 452 TMFDSLESSgssssasptgilpQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMNSSGFDPVHLGSNAFKQASMLL 540
                           ******9999**********7777778************************************************************** PP

                  GRAS 342 rkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           + ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  PGSC0003DMP400027527 541 ALFAgGDGYRVEENDGCLMLGWHTRPLIATSAWK 574
                           *********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.0E-3343108IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.0E-3143116No hitNo description
PROSITE profilePS5098567.992173553IPR005202Transcription factor GRAS
PfamPF035145.6E-137199574IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MKRDRDRERE KKSFNGGVSN GGFSGKGKIW EEDEEETPDA GMDELLAVLG YKVKSSDMAD  60
VAQKLEQLEM AMGTTMEDGI THLSTDTVHK NPSDMAGWVQ SMLSSISTNF DMCNQENELV  120
LSGCGSSSSI IDFSRNEQNH RTTTISDDDL RAIPGGAVFN SDSNKRQRSS SSFSTSMLTD  180
SSAARPVVLV DSQETGVRLV HTLMACAEAV QQENLTLADQ LVRHIGILAV SQSGAMRKVA  240
TYFAEALARR IYKIYPQDSI ESSYTDVLQM HFYETCPYLK FAHFTANQAI LEAFTGCNKV  300
HVIDFSLKQG MQWPALMQAL ALRPGGPPAF RLTGIGPPQP DNTDALQQVG WKLAQLAETI  360
GVEFEFRGFV ANSLADLDAA ILDIRPSETE AVAINSVFEL HRLLSRPGAI EKVLNSIKQI  420
NPKIVTLVEQ EANHNAGVFI DRFNEALHYY STMFDSLESS GSSSSASPTG ILPQPPVNNQ  480
DLVMSEVYLG RQICNVVACE GSDRVERHET LNQWRVRMNS SGFDPVHLGS NAFKQASMLL  540
ALFAGGDGYR VEENDGCLML GWHTRPLIAT SAWKLSPDSG TGAGEVEM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-6719457314378Protein SCARECROW
5b3h_A4e-6719457313377Protein SCARECROW
5b3h_D4e-6719457313377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400027527
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8341570.0JF834157.1 Solanum tuberosum gibberellic acid insensitive protein (GAI) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305514.10.0DELLA protein GAI
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLM1BA420.0M1BA42_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000405890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]