PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400023879 | ||||||||
Common Name | LOC102591700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 190aa MW: 21365.9 Da PI: 4.5007 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 114.7 | 4.7e-36 | 19 | 109 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +eqd+f+P nv+rim++++P + kis+dak t+++c+sefi fvt ea+ +cqre+r+ti+ +d+ w +++Gf+dy+epl +yl +y PGSC0003DMP400023879 19 QEQDQFMP--NVARIMHRTFPPHIKISDDAKWTMHDCISEFICFVTYEANARCQREQRNTITDEDVHWVTSKFGFDDYIEPLPLYLPRY 105 799***99..******************************************************************************* PP NF-YB 91 rele 94 e + PGSC0003DMP400023879 106 HEDD 109 9866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-30 | 18 | 110 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.06E-22 | 23 | 108 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.7E-15 | 27 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.9E-7 | 50 | 68 | No hit | No description |
PRINTS | PR00615 | 2.9E-7 | 69 | 87 | No hit | No description |
PRINTS | PR00615 | 2.9E-7 | 88 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MILELPSHLN QAVVEGIIQE QDQFMPNVAR IMHRTFPPHI KISDDAKWTM HDCISEFICF 60 VTYEANARCQ REQRNTITDE DVHWVTSKFG FDDYIEPLPL YLPRYHEDDG GECGSLIGES 120 LLKRPMVDTA SNCNITPYHQ PPNFPMAHHH LGYPPPMGNG DMQGDASNGS TSQCAMDNDV 180 EFPSEGGKE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 5e-39 | 18 | 107 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400023879 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006356441.2 | 1e-142 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_015168329.1 | 1e-142 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_015168330.1 | 1e-142 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_015168331.1 | 1e-142 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | Q84W66 | 1e-38 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | M1B1U8 | 1e-141 | M1B1U8_SOLTU; Uncharacterized protein | ||||
TrEMBL | M1B1V0 | 1e-141 | M1B1V0_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400035125 | 1e-142 | (Solanum tuberosum) | ||||
STRING | PGSC0003DMT400035129 | 1e-141 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA14016 | 4 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 2e-41 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400023879 |
Entrez Gene | 102591700 |