PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400023876 | ||||||||
Common Name | LOC107062333 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 180aa MW: 20202.7 Da PI: 4.6074 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 165.5 | 6.8e-52 | 21 | 114 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 reqdrf+Pianv+rim+++lP++akis+d+k+t+qecvsefisf+t ea+d+cq e+rkti+++d+lwa++++Gf+dy+epl++yl++y PGSC0003DMP400023876 21 REQDRFMPIANVVRIMRRILPSHAKISDDSKQTIQECVSEFISFITLEANDRCQSEQRKTITPEDILWAMSKVGFDDYIEPLTLYLHQY 109 89*************************************************************************************** PP NF-YB 91 releg 95 re++g PGSC0003DMP400023876 110 REFDG 114 **987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.8E-48 | 17 | 120 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.06E-37 | 23 | 120 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.4E-25 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.2E-15 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 8.2E-15 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 8.2E-15 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MERSMGMPAH LNQAITECIT REQDRFMPIA NVVRIMRRIL PSHAKISDDS KQTIQECVSE 60 FISFITLEAN DRCQSEQRKT ITPEDILWAM SKVGFDDYIE PLTLYLHQYR EFDGGESESL 120 RGEPLLLKHQ MAHHHGYFVS PPPMGNNDMQ GDASNGSTSQ CAVASVDSDV ESPVEEGKE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 8e-57 | 20 | 111 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400023876 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975444 | 0.0 | HG975444.1 Solanum pennellii chromosome ch05, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015168350.1 | 1e-134 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 1e-58 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | M1B1U5 | 1e-132 | M1B1U5_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400035117 | 1e-133 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 3e-61 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400023876 |
Entrez Gene | 107062333 |