PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400023529 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13824.9 Da PI: 7.6736 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 142.6 | 9.8e-45 | 1 | 85 | 8 | 95 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +Pianv+r+m+++lP +akis+d+k+t+qecvsefisfvt+ea+++cq rkti+++d+lwa+++lGf+dy+epl+ yl++yre++g PGSC0003DMP400023529 1 MPIANVIRVMRRILPPRAKISDDSKQTIQECVSEFISFVTGEANERCQ---RKTITAEDVLWAMSKLGFDDYIEPLTFYLHRYREFDG 85 8**********************************************7...8*********************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-40 | 1 | 88 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.6E-20 | 1 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 9.89E-32 | 1 | 88 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 2.0E-9 | 28 | 46 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 31 | 47 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.0E-9 | 63 | 81 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MPIANVIRVM RRILPPRAKI SDDSKQTIQE CVSEFISFVT GEANERCQRK TITAEDVLWA 60 MSKLGFDDYI EPLTFYLHRY REFDGGERVT LRGEKRPMLD HLLPPIAHHH AGPPPMASQH 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-50 | 1 | 82 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400023529 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975450 | 5e-92 | HG975450.1 Solanum pennellii chromosome ch11, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015166379.1 | 3e-86 | PREDICTED: nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 1e-50 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | M1B104 | 4e-85 | M1B104_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400034611 | 7e-86 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 9e-53 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400023529 |