PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400016316

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NAC

Protein Properties

Length: 151aa MW: 17308.9 Da PI: 10.1208

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400016316	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	168.9	1.7e-52	7	130	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 p+GfrFhPtdeelv++yL++k++++++ + +i+e+d+yk++PwdLp + +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk PGSC0003DMP400016316 7 PAGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYNPWDLPDLALYGEKEWYFFSPRDRKYPNGSRPNRAAGNGYWKATGADK 94 89***********************99.88***********65556799****************************** PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ + + +g+kk Lvfy g+apkgekt+W+mheyrl PGSC0003DMP400016316 95 PIGR--PKSMGIKKALVFYAGKAPKGEKTNWIMHEYRL 130 98..6789**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.42E-58	3	135	IPR003441	NAC domain
PROSITE profile	PS51005	54.957	6	150	IPR003441	NAC domain
Pfam	PF02365	4.9E-28	7	130	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009611	Biological Process	response to wounding
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 151 aa Download sequence Send to blast
MVELQFPAGF RFHPTDEELV MHYLCRKCAS QPIAVPIIAE IDLYKYNPWD LPDLALYGEK 60 EWYFFSPRDR KYPNGSRPNR AAGNGYWKAT GADKPIGRPK SMGIKKALVF YAGKAPKGEK 120 TNWIMHEYRL AHVDRSARNK NNSLRVSKMT *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-72	2	130	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00121	DAP	Transfer from AT1G01720	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400016316

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC453999	0.0	KC453999.1 Solanum lycopersicum cultivar Ailsa Craig NAC4 domain protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006351144.1	1e-106	PREDICTED: NAC domain-containing protein 2-like
Swissprot	Q39013	5e-92	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	M1AJ56	1e-109	M1AJ56_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400023917	1e-106	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	2e-94	NAC family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400016316

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]