PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400015397
Common NameLOC102591265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 298aa    MW: 34370.2 Da    PI: 7.1003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400015397genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.5e-182673148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT eEd  l ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  PGSC0003DMP400015397 26 RGPWTVEEDFTLMNYIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 73
                          89********************************************97 PP

2Myb_DNA-binding51.42.4e-1679122146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  PGSC0003DMP400015397  79 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 122
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8692173IPR017930Myb domain
SuperFamilySSF466896.36E-3123120IPR009057Homeodomain-like
SMARTSM007174.5E-142575IPR001005SANT/Myb domain
PfamPF002495.3E-162673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-222780IPR009057Homeodomain-like
CDDcd001671.61E-102873No hitNo description
PROSITE profilePS5129423.24674128IPR017930Myb domain
SMARTSM007171.3E-1478126IPR001005SANT/Myb domain
PfamPF002494.9E-1579122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2381127IPR009057Homeodomain-like
CDDcd001674.71E-799122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDHQHVKAGL SRVDANKNED DMDLRRGPWT VEEDFTLMNY IAHHGEGRWN SLARCAGLKR  60
TGKSCRLRWL NYLRPDVRRG NITLEEQLLI LELHSRWGNR WSKIAQHLPG RTDNEIKNYW  120
RTRVQKHAKQ LKCDVNSKQF KDTMRYLWMP RLVERIQAAA AGASTSKVID PQTINPNMVQ  180
IDHNNNNTNS STATASSENS FVSDLTDCCY NYPQQQQDYF QVNQSISSQL IGESLISPTG  240
YFHHALEFQG AAAADMDHQQ NTTQWMDGAN FSDNLWNIED MWFLQQQLNN NNNNNVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242312024120MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400015397
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt (NaCl). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754404e-82HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006337993.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9FGY32e-93MYB78_ARATH; Transcription factor MYB78
TrEMBLM1AGY30.0M1AGY3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000226000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.16e-90myb domain protein 78
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]