PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400012636 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 117aa MW: 13588.4 Da PI: 10.5419 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 112 | 6.6e-35 | 21 | 95 | 53 | 128 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl PGSC0003DMP400012636 21 SKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS-QTRAVGMKKTLVYYRGRAPHGARTDWVMHEYRL 95 4667**************************************.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 36.161 | 1 | 116 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.53E-36 | 20 | 100 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-18 | 20 | 95 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MIKREGFRLS SNPKGKSLLP SKDLEWYFFS PRDRKYPNGS RTNRATKAGY WKATGKDRKV 60 NSQTRAVGMK KTLVYYRGRA PHGARTDWVM HEYRLDEREC EVANGLQDAY AKYLTY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-32 | 18 | 97 | 61 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-32 | 18 | 97 | 61 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-32 | 18 | 97 | 61 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-32 | 18 | 97 | 61 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swm_B | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swm_C | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swm_D | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swp_A | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swp_B | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swp_C | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
3swp_D | 2e-32 | 18 | 97 | 64 | 147 | NAC domain-containing protein 19 |
4dul_A | 2e-32 | 18 | 97 | 61 | 144 | NAC domain-containing protein 19 |
4dul_B | 2e-32 | 18 | 97 | 61 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400012636 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC226509 | 1e-148 | AC226509.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0144P17, complete sequence. | |||
GenBank | HG975441 | 1e-148 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. | |||
GenBank | HG975514 | 1e-148 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006348211.1 | 2e-64 | PREDICTED: NAC domain-containing protein 86-like | ||||
Refseq | XP_010316553.1 | 3e-64 | NAC domain-containing protein 86 isoform X1 | ||||
Refseq | XP_010316554.1 | 1e-64 | NAC domain-containing protein 71 isoform X2 | ||||
Refseq | XP_015065777.1 | 1e-64 | NAC domain-containing protein 71-like isoform X2 | ||||
Swissprot | A4VCM0 | 2e-52 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
TrEMBL | M1AAH7 | 3e-81 | M1AAH7_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400018364 | 5e-82 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA30705 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65910.1 | 1e-58 | NAC domain containing protein 28 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400012636 |
Publications ? help Back to Top | |||
---|---|---|---|
|