PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400012163 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 185aa MW: 20218.4 Da PI: 9.99 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102 | 5.5e-32 | 26 | 82 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq Rak+e e+k +k+rkpylheSRh+hA+rR+RgsgGrF PGSC0003DMP400012163 26 EEPVYVNAKQYHGILRRRQIRAKAELERKA-IKARKPYLHESRHQHAMRRARGSGGRF 82 69***************************9.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 3.1E-36 | 24 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.291 | 25 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.2E-27 | 27 | 82 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.3E-24 | 28 | 50 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 30 | 50 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.3E-24 | 59 | 82 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MLCCQVHPHL FEIHHARMPL PLDMEEEPVY VNAKQYHGIL RRRQIRAKAE LERKAIKARK 60 PYLHESRHQH AMRRARGSGG RFLNTKKGND MDCTPEETKK YGATIPTHSG NSSGSGSSDQ 120 GGKEGSTVQD MHKGHSHSFA TGNGHGSSVY FAQSTGSEQG NGHYGRGSWN LLVNQASQGA 180 ASSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 6e-21 | 26 | 89 | 2 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400012163 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-167 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006345444.1 | 1e-130 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_006345445.1 | 1e-131 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
Swissprot | Q945M9 | 1e-33 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
TrEMBL | M1A9B4 | 1e-135 | M1A9B4_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400017698 | 1e-130 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 1e-34 | nuclear factor Y, subunit A9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400012163 |
Publications ? help Back to Top | |||
---|---|---|---|
|