PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400008227
Common NameLOC102594123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 469aa    MW: 52556.2 Da    PI: 6.5111
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400008227genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS478.43.6e-146474651374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lLl+cA++v++g+le+a+ +L ++s+lasp+gd+mqR+a+yfteALa r++rs+++lykal++++ s   +see+ ++k+f+e++P
  PGSC0003DMP400008227  47 LIHLLLACANHVAAGSLENANIALDHISQLASPSGDTMQRIASYFTEALADRILRSWPGLYKALRSTKLS--VVSEEILVRKMFFEIFP 133
                           689*************************************************************999998..6**************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                           +lk++++++NqaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+f
  PGSC0003DMP400008227 134 FLKVAFVVTNQAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTQEAEKLDIPFQF 218
                           ************************************************************....9************************ PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrll..................................................... 214
                           n  v++rle+l++e+Lrvk+gEala+++v+qlh+ll                                                     
  PGSC0003DMP400008227 219 NQ-VVSRLENLDVEKLRVKTGEALAISSVMQLHTLLahdnekksplpskhsngvnlhralvnqntlgeflekdmangcspsndtasssp 306
                           **.7******************************************************************************9988655 PP

                  GRAS 215 .desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvaceg 302
                             +++s+  ++d++L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le++lpr+s er kvE++llg+ei+n++aceg
  PGSC0003DMP400008227 307 lCSTGST--KIDSFLNALWGLSPKVMVVTEQDSNHNGTTLMERLSESLHFYAALFDCLESTLPRTSLERLKVEKMLLGEEIRNIIACEG 393
                           4444444..459***************************************************************************** PP

                  GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            er+erhe+lekW +r++++GF++vpls++a+ qa++ll+ ++ +gy+++ee+g++v++W+dr+L+svS+Wr
  PGSC0003DMP400008227 394 IERKERHEKLEKWFQRFDTSGFGNVPLSYYAMLQARRLLQSYSCEGYKIKEENGCVVICWQDRALFSVSSWR 465
                           ***********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.88421445IPR005202Transcription factor GRAS
PfamPF035141.2E-14347465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPIQIFP MMSVSPSFGS SNQWLKELKS EERGLYLIHL LLACANHVAA  60
GSLENANIAL DHISQLASPS GDTMQRIASY FTEALADRIL RSWPGLYKAL RSTKLSVVSE  120
EILVRKMFFE IFPFLKVAFV VTNQAIIEAM EGEKMVHIVD LNAAEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLTQEAE KLDIPFQFNQ VVSRLENLDV EKLRVKTGEA  240
LAISSVMQLH TLLAHDNEKK SPLPSKHSNG VNLHRALVNQ NTLGEFLEKD MANGCSPSND  300
TASSSPLCST GSTKIDSFLN ALWGLSPKVM VVTEQDSNHN GTTLMERLSE SLHFYAALFD  360
CLESTLPRTS LERLKVEKML LGEEIRNIIA CEGIERKERH EKLEKWFQRF DTSGFGNVPL  420
SYYAMLQARR LLQSYSCEGY KIKEENGCVV ICWQDRALFS VSSWRCRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-41294671381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400008227
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349782.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM1A0990.0M1A099_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  3. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  4. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]