![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400008158 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 235aa MW: 27770.9 Da PI: 7.1133 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.3 | 1.3e-16 | 5 | 52 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eEd l +++ +G g+W++ +r+ g++Rt+k+c++rw++yl PGSC0003DMP400008158 5 RGPWSVEEDFVLMNYISHHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 52 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.9 | 1.8e-16 | 58 | 101 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ PGSC0003DMP400008158 58 RGNITLEEQLLILQLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 101 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.574 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.64E-30 | 2 | 99 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.1E-13 | 4 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-14 | 5 | 52 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-21 | 6 | 59 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.25E-8 | 7 | 52 | No hit | No description |
SMART | SM00717 | 1.2E-14 | 57 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.681 | 57 | 107 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.4E-15 | 58 | 101 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-23 | 60 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.73E-6 | 78 | 101 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MELRRGPWSV EEDFVLMNYI SHHGEGRWNS LSRCAGLKRT GKSCRLRWLN YLRPDVRRGN 60 ITLEEQLLIL QLHSRWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKHAKQL KCDVNSKQFQ 120 DTLRYLWIPR LVERIQASKI SNNNSSSETQ QPVQLMNNNN NSILITSVTP ENSSVATSSE 180 NSNQDYYQVN QSDQLWFEDY QAMDQQNNIE LWMDNEDIFN NLCNNEDIWS LLEH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-25 | 2 | 99 | 24 | 120 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400008158 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU934734 | 0.0 | EU934734.1 Solanum lycopersicum ABA-induced MYB transcription factor (AIM1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006349958.1 | 1e-173 | PREDICTED: transcription factor MYB108-like isoform X1 | ||||
Refseq | XP_015165250.1 | 1e-173 | PREDICTED: transcription factor MYB108-like isoform X2 | ||||
Swissprot | Q10MB4 | 1e-85 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | M1A031 | 1e-171 | M1A031_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400011745 | 1e-172 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1397 | 23 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49620.1 | 2e-85 | myb domain protein 78 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400008158 |