PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400008158

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

MYB

Protein Properties

Length: 235aa MW: 27770.9 Da PI: 7.1133

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400008158	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.3	1.3e-16	5	52	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eEd l +++ +G g+W++ +r+ g++Rt+k+c++rw++yl PGSC0003DMP400008158 5 RGPWSVEEDFVLMNYISHHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 52 89********************************************97 PP
2	Myb_DNA-binding	51.9	1.8e-16	58	101	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ PGSC0003DMP400008158 58 RGNITLEEQLLILQLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 101 7999****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	23.574	1	56	IPR017930	Myb domain
SuperFamily	SSF46689	1.64E-30	2	99	IPR009057	Homeodomain-like
SMART	SM00717	9.1E-13	4	54	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-14	5	52	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.3E-21	6	59	IPR009057	Homeodomain-like
CDD	cd00167	1.25E-8	7	52	No hit	No description
SMART	SM00717	1.2E-14	57	105	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.681	57	107	IPR017930	Myb domain
Pfam	PF00249	3.4E-15	58	101	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.5E-23	60	106	IPR009057	Homeodomain-like
CDD	cd00167	1.73E-6	78	101	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0046686	Biological Process	response to cadmium ion
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 235 aa Download sequence Send to blast
MELRRGPWSV EEDFVLMNYI SHHGEGRWNS LSRCAGLKRT GKSCRLRWLN YLRPDVRRGN 60 ITLEEQLLIL QLHSRWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKHAKQL KCDVNSKQFQ 120 DTLRYLWIPR LVERIQASKI SNNNSSSETQ QPVQLMNNNN NSILITSVTP ENSSVATSSE 180 NSNQDYYQVN QSDQLWFEDY QAMDQQNNIE LWMDNEDIFN NLCNNEDIWS LLEH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	7e-25	2	99	24	120	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400008158

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU934734	0.0	EU934734.1 Solanum lycopersicum ABA-induced MYB transcription factor (AIM1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006349958.1	1e-173	PREDICTED: transcription factor MYB108-like isoform X1
Refseq	XP_015165250.1	1e-173	PREDICTED: transcription factor MYB108-like isoform X2
Swissprot	Q10MB4	1e-85	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	M1A031	1e-171	M1A031_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400011745	1e-172	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1397	23	75

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49620.1	2e-85	myb domain protein 78

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400008158

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]