PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400008158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 235aa    MW: 27770.9 Da    PI: 7.1133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400008158genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-16552148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+W+ eEd  l +++  +G g+W++ +r+ g++Rt+k+c++rw++yl
  PGSC0003DMP400008158  5 RGPWSVEEDFVLMNYISHHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 52
                          89********************************************97 PP

2Myb_DNA-binding51.91.8e-1658101146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  PGSC0003DMP400008158  58 RGNITLEEQLLILQLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 101
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.574156IPR017930Myb domain
SuperFamilySSF466891.64E-30299IPR009057Homeodomain-like
SMARTSM007179.1E-13454IPR001005SANT/Myb domain
PfamPF002491.5E-14552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-21659IPR009057Homeodomain-like
CDDcd001671.25E-8752No hitNo description
SMARTSM007171.2E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129418.68157107IPR017930Myb domain
PfamPF002493.4E-1558101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2360106IPR009057Homeodomain-like
CDDcd001671.73E-678101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MELRRGPWSV EEDFVLMNYI SHHGEGRWNS LSRCAGLKRT GKSCRLRWLN YLRPDVRRGN  60
ITLEEQLLIL QLHSRWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKHAKQL KCDVNSKQFQ  120
DTLRYLWIPR LVERIQASKI SNNNSSSETQ QPVQLMNNNN NSILITSVTP ENSSVATSSE  180
NSNQDYYQVN QSDQLWFEDY QAMDQQNNIE LWMDNEDIFN NLCNNEDIWS LLEH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-2529924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400008158
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9347340.0EU934734.1 Solanum lycopersicum ABA-induced MYB transcription factor (AIM1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349958.11e-173PREDICTED: transcription factor MYB108-like isoform X1
RefseqXP_015165250.11e-173PREDICTED: transcription factor MYB108-like isoform X2
SwissprotQ10MB41e-85MYB2_ORYSJ; Transcription factor MYB2
TrEMBLM1A0311e-171M1A031_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000117451e-172(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-85myb domain protein 78
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  4. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  5. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  6. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]