PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400006327 | ||||||||
Common Name | LOC102603672 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 128aa MW: 13994.1 Da PI: 10.8234 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60.3 | 2.5e-19 | 48 | 82 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l PGSC0003DMP400006327 48 CSHCGVQKTPQWRAGPMGAKTLCNACGVRFKSGRL 82 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 11.78 | 42 | 78 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 3.7E-16 | 42 | 96 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.28E-15 | 43 | 106 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.4E-15 | 46 | 80 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.00E-12 | 47 | 95 | No hit | No description |
Pfam | PF00320 | 3.1E-17 | 48 | 82 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 48 | 73 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MSSSPTASWF LYPTPVHSAE SPGKPLAKKL KKKPAPHGGN GPQQPRRCSH CGVQKTPQWR 60 AGPMGAKTLC NACGVRFKSG RLLPEYRPAC SPTFSTELHS NNHRKVLEMR RKKESEETGL 120 AQPVQSF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400006327 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 1e-152 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006340696.1 | 7e-90 | PREDICTED: GATA transcription factor 5-like | ||||
Swissprot | Q9FH57 | 9e-48 | GATA5_ARATH; GATA transcription factor 5 | ||||
TrEMBL | M0ZVM0 | 2e-88 | M0ZVM0_SOLTU; GATA transcription factor | ||||
STRING | PGSC0003DMT400009118 | 3e-89 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66320.2 | 9e-48 | GATA transcription factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400006327 |
Entrez Gene | 102603672 |
Publications ? help Back to Top | |||
---|---|---|---|
|