PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400006285

Common Name

LOC102593731

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

bZIP

Protein Properties

Length: 145aa MW: 16432.4 Da PI: 5.209

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400006285	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	41.4	3.1e-13	22	80	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NRe+ArrsR +K+ + eL v +L+++N + +++++ ++ + ++++e+ PGSC0003DMP400006285 22 RKRKRMISNRESARRSRMKKQTHLNELMAQVNQLKEQNNQIVSNINMVSQVYLNVEAEN 80 6789*******************************************999998888776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	9.0E-12	12	70	No hit	No description
SMART	SM00338	8.1E-17	18	82	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.404	20	83	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.4E-9	22	69	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.38E-12	22	75	No hit	No description
CDD	cd14702	2.35E-16	23	71	No hit	No description
PROSITE pattern	PS00036	0	25	40	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009744	Biological Process	response to sucrose
GO:0080149	Biological Process	sucrose induced translational repression
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 145 aa Download sequence Send to blast
MASPSGNSSS GSEDLQQLMD QRKRKRMISN RESARRSRMK KQTHLNELMA QVNQLKEQNN 60 QIVSNINMVS QVYLNVEAEN SVLRAQMAEL SNRLQSLNEI INCINSANST IDETEINCED 120 DFLNPWNLLH VNQPIMASAD AFMY*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:18088315, ECO:0000269\|PubMed:21534971, ECO:0000269\|PubMed:24861440}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00470	DAP	Transfer from AT4G34590	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400006285

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:15208401, ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC226001	1e-128	AC226001.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0116F10, complete sequence.
GenBank	HG975514	1e-128	HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004232435.1	1e-101	bZIP transcription factor 11-like
Refseq	XP_006340665.1	1e-101	PREDICTED: bZIP transcription factor 53-like
Swissprot	O65683	5e-43	BZP11_ARATH; bZIP transcription factor 11
TrEMBL	A0A3Q7F7D5	1e-99	A0A3Q7F7D5_SOLLC; Uncharacterized protein
TrEMBL	M0ZVK3	1e-99	M0ZVK3_SOLTU; Uncharacterized protein
STRING	Solyc02g084860.1.1	1e-100	(Solanum lycopersicum)
STRING	PGSC0003DMT400009068	1e-100	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA537	24	123

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34590.1	3e-45	G-box binding factor 6

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400006285
Entrez Gene	102593731

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Mair A, et al. SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants. Elife, 2016. [PMID:26263501] Sagor GH, et al. A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene. Plant Biotechnol. J., 2016. 14(4): p. 1116-26 [PMID:26402509] Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins. PLoS ONE, 2016. 11(4): p. e0153216 [PMID:27073862] Wang XY, et al. Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis. Plant Physiol. Biochem., 2016. 107: p. 273-287 [PMID:27337039] Weiste C, et al. The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth. PLoS Genet., 2017. 13(2): p. e1006607 [PMID:28158182] Yamashita Y, et al. Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2. FEBS Lett., 2017. 591(9): p. 1266-1277 [PMID:28369795] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Lee DH,Park SJ,Ahn CS,Pai HS MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway. Plant Cell, 2017. 29(11): p. 2895-2920 [PMID:29084871] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]