PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400006285 | ||||||||
Common Name | LOC102593731 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 145aa MW: 16432.4 Da PI: 5.209 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.4 | 3.1e-13 | 22 | 80 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NRe+ArrsR +K+ + eL v +L+++N + +++++ ++ + ++++e+ PGSC0003DMP400006285 22 RKRKRMISNRESARRSRMKKQTHLNELMAQVNQLKEQNNQIVSNINMVSQVYLNVEAEN 80 6789*******************************************999998888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 9.0E-12 | 12 | 70 | No hit | No description |
SMART | SM00338 | 8.1E-17 | 18 | 82 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.404 | 20 | 83 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.4E-9 | 22 | 69 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.38E-12 | 22 | 75 | No hit | No description |
CDD | cd14702 | 2.35E-16 | 23 | 71 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 25 | 40 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009744 | Biological Process | response to sucrose | ||||
GO:0080149 | Biological Process | sucrose induced translational repression | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MASPSGNSSS GSEDLQQLMD QRKRKRMISN RESARRSRMK KQTHLNELMA QVNQLKEQNN 60 QIVSNINMVS QVYLNVEAEN SVLRAQMAEL SNRLQSLNEI INCINSANST IDETEINCED 120 DFLNPWNLLH VNQPIMASAD AFMY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00470 | DAP | Transfer from AT4G34590 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400006285 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC226001 | 1e-128 | AC226001.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0116F10, complete sequence. | |||
GenBank | HG975514 | 1e-128 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004232435.1 | 1e-101 | bZIP transcription factor 11-like | ||||
Refseq | XP_006340665.1 | 1e-101 | PREDICTED: bZIP transcription factor 53-like | ||||
Swissprot | O65683 | 5e-43 | BZP11_ARATH; bZIP transcription factor 11 | ||||
TrEMBL | A0A3Q7F7D5 | 1e-99 | A0A3Q7F7D5_SOLLC; Uncharacterized protein | ||||
TrEMBL | M0ZVK3 | 1e-99 | M0ZVK3_SOLTU; Uncharacterized protein | ||||
STRING | Solyc02g084860.1.1 | 1e-100 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400009068 | 1e-100 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA537 | 24 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 3e-45 | G-box binding factor 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400006285 |
Entrez Gene | 102593731 |