PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400004393 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 169aa MW: 19278.7 Da PI: 10.8327 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.2 | 1.2e-32 | 15 | 71 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 dep++VNaKQyq+Il+RRq Ra+le+++kl +k+rkpylheSRh+hAl+R+Rg+gGrF PGSC0003DMP400004393 15 DEPIFVNAKQYQAILRRRQYRARLEAQNKL-SKGRKPYLHESRHRHALNRARGPGGRF 71 79****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-33 | 13 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 34.838 | 14 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.3E-27 | 16 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.3E-22 | 17 | 39 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.3E-22 | 48 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MVSPRVPLPL DLKQDEPIFV NAKQYQAILR RRQYRARLEA QNKLSKGRKP YLHESRHRHA 60 LNRARGPGGR FVNMKKPRES KSPDLINGQD NQVSDELQLN RKMLEPNIHQ SRSYSTPVYS 120 GITSGSNGDA IYHHQSFKYS AFSARNRGTS QLDKEKKDNT SNPCLSSF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 7e-22 | 15 | 85 | 2 | 69 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400004393 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 1e-127 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006342951.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit A-3-like | ||||
Swissprot | Q93ZH2 | 3e-36 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
TrEMBL | M0ZR70 | 1e-121 | M0ZR70_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400006358 | 1e-121 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72830.1 | 1e-38 | nuclear factor Y, subunit A3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400004393 |
Publications ? help Back to Top | |||
---|---|---|---|
|