PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400003753
Organism
Solanum tuberosum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 57aa    MW: 6500.47 Da    PI: 4.3983
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400003753genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM607.7e-19652148
                   NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                          lppGfrFhPtd+elv +yLk+k+++ ++el evi+ +d+yk++PwdLp
  PGSC0003DMP400003753  6 LPPGFRFHPTDQELVGYYLKRKTDELEIEL-EVIPVIDLYKFDPWDLP 52
                          79****************************.99**************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-20455IPR003441NAC domain
PROSITE profilePS5100521.721656IPR003441NAC domain
PfamPF023653.1E-9748IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
MAGISLPPGF RFHPTDQELV GYYLKRKTDE LEIELEVIPV IDLYKFDPWD LPGIHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-162521161Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400003753
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-83HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015079596.11e-30NAC domain-containing protein 71-like
SwissprotO496972e-24NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A2G2WK373e-32A0A2G2WK37_CAPBA; NAC domain-containing protein 45
TrEMBLA0A2G3C7N16e-30A0A2G3C7N1_CAPCH; NAC domain-containing protein 45
TrEMBLM0ZPR86e-33M0ZPR8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000053561e-33(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-16NAC domain containing protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  4. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]