PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.1328s0080.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 162aa MW: 17797.1 Da PI: 6.7367 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 142.1 | 1.7e-44 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ SapurV1A.1328s0080.1.p 10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQV 96 7************************************************************************************** PP DUF260 88 eqlkaelallke 99 +l++el+++++ SapurV1A.1328s0080.1.p 97 IRLQKELDATNA 108 *******99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.673 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.3E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVLP 60 HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVIRLQ KELDATNADL IRYACNEMPA 120 ANPQFARRMG HGGVSYDQSS GIYYPSPWND EPCGERGDGG V* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-67 | 3 | 118 | 4 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-67 | 3 | 118 | 4 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.1328s0080.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002300051.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467046.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467049.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467052.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467061.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467064.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467066.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Refseq | XP_024467071.1 | 1e-115 | LOB domain-containing protein 25 | ||||
Swissprot | Q8L8Q3 | 2e-68 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 5e-68 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | B9GI56 | 1e-113 | B9GI56_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0001s35280.1 | 1e-114 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 8e-71 | LOB domain-containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.1328s0080.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|