PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0697s0120.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 114aa MW: 13558.6 Da PI: 10.6872 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50 | 6.9e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l +v+++G +W+ ++ g+ R++k+c++rw +yl SapurV1A.0697s0120.1.p 14 KGAWSKEEDDKLRVYVQKYGHWNWRQLPKFAGLSRCGKSCRLRWMNYL 61 79******************99************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-23 | 7 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.962 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 4.4E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.8E-23 | 15 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.90E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.135 | 62 | 101 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-9 | 65 | 92 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MVKATLVDKN GFRKGAWSKE EDDKLRVYVQ KYGHWNWRQL PKFAGLSRCG KSCRLRWMNY 60 LRPDVKRGNF SHQEDNLILQ MHEELENKRS QIMPDDKPRR SARIIKPNPK YAQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-15 | 12 | 92 | 25 | 104 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0697s0120.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002325683.2 | 2e-56 | transcription repressor MYB6 | ||||
Refseq | XP_011047493.1 | 2e-56 | PREDICTED: myb-related protein 308-like | ||||
Swissprot | P20026 | 8e-34 | MYB1_HORVU; Myb-related protein Hv1 | ||||
Swissprot | Q9LDR8 | 1e-33 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | B9INU5 | 5e-55 | B9INU5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0019s14120.1 | 8e-56 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF356 | 33 | 186 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G16770.2 | 7e-37 | myb domain protein 9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0697s0120.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|