PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0333s0300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 234aa MW: 27128 Da PI: 7.853 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.7 | 1.1e-26 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien++ rqvtfskRr+g+lKK +ELSvLCda++ +i+fsstgkl y++ SapurV1A.0333s0300.1.p 10 RIENQTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIVFSSTGKLCQYCT 59 8***********************************************96 PP | |||||||
2 | K-box | 65.1 | 2.5e-22 | 81 | 170 | 10 | 99 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 e+ e+l ela L+ke+ Lq++ R++ ed++++ ++eL +eqqLe+s++k+R++Kn+ll++q+e+l++ke++l+ee ++ + SapurV1A.0333s0300.1.p 81 EHDSREQLFGELAMLRKETLLLQSNMRRYTCEDMSPIPFEELDAIEQQLERSVNKVRDRKNQLLHQQLENLRRKERMLEEESSNMYR 167 4455677888***********************************************************************998877 PP K-box 97 kle 99 ++ SapurV1A.0333s0300.1.p 168 WIQ 170 665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.109 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-30 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.92E-41 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.4E-21 | 81 | 169 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.138 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRGKIAIRR IENQTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIVFSS TGKLCQYCTE 60 GLRMEQIIER YQKMTGTCIP EHDSREQLFG ELAMLRKETL LLQSNMRRYT CEDMSPIPFE 120 ELDAIEQQLE RSVNKVRDRK NQLLHQQLEN LRRKERMLEE ESSNMYRWIQ EHRAALGYQQ 180 AAIEVKPAEH QQVLDQFPFC GEPSSVLQLS NITHQIDPYH LQLAQPSLQG SNV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-19 | 1 | 71 | 1 | 69 | MEF2C |
5f28_B | 9e-19 | 1 | 71 | 1 | 69 | MEF2C |
5f28_C | 9e-19 | 1 | 71 | 1 | 69 | MEF2C |
5f28_D | 9e-19 | 1 | 71 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0333s0300.1.p |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC216682 | 8e-77 | AC216682.1 Populus trichocarpa clone POP024-L07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011022027.1 | 1e-152 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Refseq | XP_011022028.1 | 1e-152 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Swissprot | Q8RYD9 | 1e-88 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A2K1ZQP2 | 1e-150 | A0A2K1ZQP2_POPTR; Uncharacterized protein | ||||
STRING | XP_002513703.1 | 1e-138 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4935 | 29 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 6e-91 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0333s0300.1.p |