PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0247s0220.8.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 181aa MW: 19940.8 Da PI: 10.0217 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.8 | 1.4e-14 | 83 | 127 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT+eE++++++a +++ + Wk+I +g +t q++s+ qky SapurV1A.0247s0220.8.p 83 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 127 789*****************77.*********.*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.21E-18 | 77 | 133 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.094 | 78 | 132 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-7 | 81 | 133 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 5.3E-19 | 81 | 130 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.1E-11 | 82 | 130 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-12 | 83 | 127 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.85E-10 | 85 | 128 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MPFTRPVFPS SPFCTQFHAL EKEKLCMIMS TNLSSSTSGE GAGAEANPGG PAHSMATPPP 60 AATASSDGSG KKVRKPYTIT KSRESWTEEE HDKFLEALQL FDRDWKKIED FVGSKTVIQI 120 RSHAQKYFLK IQKNGTVAHL PPPRPKRKAS HPYPQKASKI GLTILTKYDD KCYCTLKSPS 180 * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0247s0220.8.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF148355 | 1e-138 | EF148355.1 Populus trichocarpa x Populus deltoides clone WS01313_L11 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006373855.1 | 7e-69 | protein REVEILLE 8 isoform X1 | ||||
Refseq | XP_024442937.1 | 7e-69 | protein REVEILLE 8 isoform X1 | ||||
Refseq | XP_024442939.1 | 6e-69 | protein REVEILLE 8 isoform X3 | ||||
Swissprot | Q8RWU3 | 4e-63 | RVE8_ARATH; Protein REVEILLE 8 | ||||
TrEMBL | A0A2K1XCP4 | 2e-67 | A0A2K1XCP4_POPTR; Uncharacterized protein | ||||
TrEMBL | A0A3N7HXM2 | 1e-67 | A0A3N7HXM2_POPTR; Uncharacterized protein | ||||
TrEMBL | A9PIX5 | 6e-68 | A9PIX5_9ROSI; Uncharacterized protein | ||||
STRING | POPTR_0016s08470.1 | 2e-68 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09600.1 | 5e-62 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0247s0220.8.p |
Publications ? help Back to Top | |||
---|---|---|---|
|