PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0168s0470.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 179aa MW: 20467.9 Da PI: 9.227 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.1 | 6.4e-32 | 99 | 157 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk s+fprsYYrCts+gC+vkk+v+r+++d+ +v++tYeg Hnh SapurV1A.0168s0470.1.p 99 LDDGYRWRKYGQKTVKCSRFPRSYYRCTSNGCNVKKQVQRNSKDEGIVVTTYEGMHNHA 157 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.4E-33 | 84 | 157 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.41E-28 | 91 | 157 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.32 | 94 | 159 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.8E-35 | 99 | 158 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.3E-25 | 100 | 156 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MSMEKYQIFL PVSGPSSPSV SPSSLSIENP VIYFHGDSEN EVRPESRFQH LDAKNSVSQT 60 SRICKGSELR VKPGKRVGDS DDCRKHRFAF QTRSQVDILD DGYRWRKYGQ KTVKCSRFPR 120 SYYRCTSNGC NVKKQVQRNS KDEGIVVTTY EGMHNHATER SSENFEDILR QIQTCTPF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 89 | 156 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 89 | 156 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0168s0470.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF179613 | 1e-139 | EF179613.1 (Populus tomentosa x P. bolleana) x P. tomentosa putative WRKY transcription factor 01 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002322274.1 | 1e-104 | probable WRKY transcription factor 43 | ||||
Swissprot | Q9FYA2 | 6e-44 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | B9IFE4 | 1e-103 | B9IFE4_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0015s11130.1 | 1e-103 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 5e-46 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0168s0470.1.p |