PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0081s0610.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 110aa MW: 12805 Da PI: 8.2236 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 69.2 | 6e-22 | 24 | 79 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+W+KYGqK +k+ rsY++C ++C +kk+ve s+ p+ + i Y+g+H h SapurV1A.0081s0610.1.p 24 EDGYEWKKYGQKFIKNIGKIRSYFKCQKRNCVAKKRVEWSS--PNHLRIEYKGSHSHV 79 7***************************************9..*************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 16.099 | 18 | 81 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.98E-20 | 20 | 78 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.1E-21 | 20 | 79 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.2E-19 | 23 | 80 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.1E-19 | 24 | 78 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
ETHEEVDREE QDTDRGGQRL VLPEDGYEWK KYGQKFIKNI GKIRSYFKCQ KRNCVAKKRV 60 EWSSPNHLRI EYKGSHSHVS STQGTNQYNL YTQVFGDDQP ASRTHDQDA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0081s0610.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024452204.1 | 9e-55 | probable WRKY transcription factor 26 isoform X2 | ||||
Swissprot | Q9FG77 | 3e-12 | WRKY2_ARATH; Probable WRKY transcription factor 2 | ||||
TrEMBL | A0A3N7EQW7 | 2e-53 | A0A3N7EQW7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0003s20860.1 | 1e-53 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF18950 | 5 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56270.1 | 1e-14 | WRKY DNA-binding protein 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0081s0610.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|