PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SapurV1A.0072s0330.3.p

Organism

Salix purpurea

Taxonomic ID

77065

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix

Family

YABBY

Protein Properties

Length: 144aa MW: 15780.8 Da PI: 9.2807

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SapurV1A.0072s0330.3.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	112.7	6.7e-35	2	129	32	163
YABBY 32 fkvvtvrCGhCtsllsvnlakas..qllaaeshldeslkeelleelkveeenlksnvekeesastsv..sseklsenedeevprvpp 114 + +vtv+CGhC +l ++ + + + +h + s+ ++v++++ +e++ s + + s++++ vp+vp SapurV1A.0072s0330.3.p 2 LDTVTVKCGHCNNLSFLSTRPPNlgHCFDI-DHHQLSF-------QGVSGNEKLLFKETQGFCSDFGkgEYASSSTSSEPLVPKVPF 80 679*******986544443331122222.2212222.......2222222222222222222222002222356677789* PP YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 v++PPek+ r Ps+ynrf+keeiqrika+nP+i hreafs+aaknWa + SapurV1A.0072s0330.3.p 81 VVKPPEKKHRLPSTYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARY 129 *********************************************75 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.6E-37	1	129	IPR006780	YABBY protein
SuperFamily	SSF47095	8.64E-8	77	128	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	1.5E-4	83	128	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MLDTVTVKCG HCNNLSFLST RPPNLGHCFD IDHHQLSFQG VSGNEKLLFK ETQGFCSDFG 60 KGEYASSSTS SEPLVPKVPF VVKPPEKKHR LPSTYNRFMK EEIQRIKAAN PEIPHREAFS 120 TAAKNWARYL PNSAGAGSGG SKN*

Functional Description ? help Back to Top
Source	Description
UniProt	Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269\|PubMed:14729915}.
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	SapurV1A.0072s0330.3.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC209103	5e-46	AC209103.1 Populus trichocarpa clone POP056-L16, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024467056.1	4e-86	protein CRABS CLAW
Swissprot	Q76EJ0	8e-42	YABDL_ORYSJ; Protein DROOPING LEAF
Swissprot	Q8L925	4e-42	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A3N7FSH3	3e-87	A0A3N7FSH3_POPTR; Uncharacterized protein
STRING	POPTR_0010s16410.1	6e-88	(Populus trichocarpa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	5e-35	YABBY family protein

Link Out ? help Back to Top
Phytozome	SapurV1A.0072s0330.3.p

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]