PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0068s0650.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 215aa MW: 25056.7 Da PI: 8.7045 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.1 | 3e-30 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien s rqvtfskRrng+lKKA ELSvLCdaevaviifs++gklye++s SapurV1A.0068s0650.1.p 10 RIENASSRQVTFSKRRNGLLKKARELSVLCDAEVAVIIFSQNGKLYEFAS 59 8***********************************************86 PP | |||||||
2 | K-box | 70.5 | 5.3e-24 | 85 | 173 | 11 | 99 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 e e+l+ e++++ ++ie ++ +qR+llG+dL+++s +eLq++ +qLe sl++iR++K+ l++eqie+lq ke+ l een +Lrk+ SapurV1A.0068s0650.1.p 85 ELYKEQLRYESENMARKIEIIKMSQRKLLGKDLDPCSSEELQEISRQLEISLNNIRARKDWLFKEQIEQLQAKERLLLEENARLRKQ 171 556788999*****************************************************************************9 PP K-box 98 le 99 + SapurV1A.0068s0650.1.p 172 CD 173 76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.0E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.226 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.51E-40 | 3 | 71 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-31 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.6E-22 | 88 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.336 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MVRGKIQMRR IENASSRQVT FSKRRNGLLK KARELSVLCD AEVAVIIFSQ NGKLYEFAST 60 DNMQNTIERY RIDAKQGYTD RIDEELYKEQ LRYESENMAR KIEIIKMSQR KLLGKDLDPC 120 SSEELQEISR QLEISLNNIR ARKDWLFKEQ IEQLQAKERL LLEENARLRK QCDAQPWLQI 180 STQPNQAVAY LSSCSKSSDV ETELFIGVPQ MRCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 2e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0068s0650.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002318261.1 | 1e-109 | MADS-box protein AGL42 | ||||
Refseq | XP_024437836.1 | 1e-109 | MADS-box protein AGL42 | ||||
Swissprot | Q9FIS1 | 5e-71 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | B9I4G5 | 1e-108 | B9I4G5_POPTR; Uncharacterized protein | ||||
STRING | XP_002510866.1 | 3e-83 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-66 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0068s0650.1.p |