PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0036s0350.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 226aa MW: 25273 Da PI: 6.9625 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.6 | 3.2e-09 | 23 | 65 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 rWT eEd+++ +a + ++ + +W +Ia+++ +++ ++k+++ SapurV1A.0036s0350.1.p 23 RWTREEDKIFEQALTVFPENlpdRWQSIANHIR--KSAWEVKEHY 65 9*******************************8..8********9 PP | |||||||
2 | Myb_DNA-binding | 43.2 | 9.1e-14 | 131 | 175 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E++l++ + ++G+g+W++I+r + +Rt+ q+ s+ qky SapurV1A.0036s0350.1.p 131 PWTEDEHKLFLVGLSKFGKGDWRSISRNVVITRTPTQVASHAQKY 175 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.76 | 16 | 69 | IPR017877 | Myb-like domain |
SMART | SM00717 | 9.0E-8 | 20 | 71 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.69E-7 | 23 | 65 | No hit | No description |
Pfam | PF00249 | 5.9E-6 | 23 | 65 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.45E-12 | 23 | 77 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.7E-4 | 23 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.415 | 124 | 180 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.31E-16 | 125 | 181 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.6E-17 | 127 | 179 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.2E-11 | 128 | 178 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-10 | 128 | 174 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.46E-9 | 131 | 176 | No hit | No description |
Pfam | PF00249 | 1.4E-12 | 131 | 175 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MHQDFNFQTR CLTQPPHDAA SARWTREEDK IFEQALTVFP ENLPDRWQSI ANHIRKSAWE 60 VKEHYDVLVH DVFAIDSGRV ELPTYRDDDS VRWESGGAGG GMVAADAQPS GQICFGGGKA 120 KQDTERKKGT PWTEDEHKLF LVGLSKFGKG DWRSISRNVV ITRTPTQVAS HAQKYFLRQN 180 SVKKERKRSS IHDITSVDNN TVGPSADDYW NSPSVPPTNP DGPPG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 6e-13 | 24 | 86 | 11 | 74 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0036s0350.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002316492.2 | 1e-149 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 8e-57 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | B9HVV5 | 1e-148 | B9HVV5_POPTR; MYB family protein | ||||
STRING | POPTR_0010s24710.1 | 1e-149 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6068 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 4e-79 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0036s0350.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|