PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0023s0530.7.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 123aa MW: 13591.3 Da PI: 5.2553 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.1 | 9.3e-57 | 25 | 118 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+y+eplkvyl SapurV1A.0023s0530.7.p 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYIEPLKVYL 111 69************************************************************************************* PP NF-YB 88 kkyrele 94 ++yre+ SapurV1A.0023s0530.7.p 112 ARYREVI 118 *****85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.0E-53 | 20 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.38E-39 | 28 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.9E-29 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.6E-22 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.6E-22 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 7.6E-22 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MADNPTSPAA GSHDSGGEQS PRSGVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ 60 ECVSEFISFV TSEASDKCQK EKRKTINGDD LLWAMATLGF EEYIEPLKVY LARYREVISF 120 DF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 6e-48 | 26 | 116 | 3 | 93 | NF-YB |
4awl_B | 6e-48 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 6e-48 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00300 | DAP | Transfer from AT2G38880 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0023s0530.7.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011037351.1 | 4e-81 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_011038112.1 | 4e-81 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_024461881.1 | 4e-81 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461882.1 | 4e-81 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461883.1 | 4e-81 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024461884.1 | 2e-81 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Swissprot | Q8VYK4 | 6e-66 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
Swissprot | Q9SLG0 | 2e-66 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A2K1ZBP5 | 8e-80 | A0A2K1ZBP5_POPTR; Uncharacterized protein | ||||
TrEMBL | A0A2K1ZBP6 | 4e-80 | A0A2K1ZBP6_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0008s04440.1 | 5e-80 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.6 | 4e-69 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0023s0530.7.p |
Publications ? help Back to Top | |||
---|---|---|---|
|