PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo9G0049100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 155aa MW: 18409.8 Da PI: 8.7351 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 166 | 1.3e-51 | 16 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 l+pGfrFhPt+eelv +yL++kveg+++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s+ Spipo9G0049100 16 LMPGFRFHPTEEELVEFYLRRKVEGRPFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSE 109 689***************************.89***************888889***************************************** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +glkktLvfy+g+apkg++t+W+m+eyrl Spipo9G0049100 110 SSRSIGLKKTLVFYSGKAPKGVRTSWIMNEYRL 142 *******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.31E-55 | 14 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.941 | 16 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.3E-26 | 18 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MNSREEDDDG HEHDVLMPGF RFHPTEEELV EFYLRRKVEG RPFNVELITF LDLYRYDPWE 60 LPAMAAIGEK EWFFYVPRDR KYRNGDRPNR VTTSGYWKAT GADRMIRSES SRSIGLKKTL 120 VFYSGKAPKG VRTSWIMNEY RLPHHETDRY LKVL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-54 | 6 | 142 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-54 | 6 | 142 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-54 | 6 | 142 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-54 | 6 | 142 | 7 | 142 | NO APICAL MERISTEM PROTEIN |
4dul_A | 1e-54 | 6 | 142 | 7 | 142 | NAC domain-containing protein 19 |
4dul_B | 1e-54 | 6 | 142 | 7 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022897039.1 | 9e-99 | NAC domain-containing protein 35-like | ||||
Refseq | XP_028793227.1 | 1e-98 | NAC domain-containing protein 35-like | ||||
Swissprot | Q9ZVP8 | 9e-92 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A2P5BY54 | 8e-97 | A0A2P5BY54_PARAD; NAC domain containing protein | ||||
STRING | XP_008382796.1 | 6e-97 | (Malus domestica) | ||||
STRING | XP_009626107.1 | 1e-96 | (Nicotiana tomentosiformis) | ||||
STRING | XP_004301581.1 | 4e-96 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2826 | 37 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 3e-94 | NAC domain containing protein 35 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo9G0049100 |
Publications ? help Back to Top | |||
---|---|---|---|
|