PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo6G0064900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 169aa MW: 18601.7 Da PI: 6.7831 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.5 | 2e-15 | 17 | 60 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 W +Ede l ++v +G ++Wk+I++ ++ gRt+ c+srw++ Spipo6G0064900 17 MWNSDEDEALRRLVDHFGDRNWKLISAAIP-GRTPRACRSRWLNC 60 5*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 49.7 | 8.3e-16 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T++Ede+++ a +++G++ W+tIar ++ gRt+ + rw + Spipo6G0064900 67 RGPFTADEDEIIIAAQAKHGNR-WATIARLLP-GRTGPAVEYRWCT 110 89********************.*********.***********76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.188 | 10 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.27E-28 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-11 | 14 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.8E-22 | 18 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.61E-12 | 18 | 59 | No hit | No description |
Pfam | PF13921 | 1.0E-14 | 18 | 75 | No hit | No description |
PROSITE profile | PS51294 | 16.875 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.0E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-19 | 69 | 111 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.05E-10 | 69 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MGDAAEDEGG RSAVKRMWNS DEDEALRRLV DHFGDRNWKL ISAAIPGRTP RACRSRWLNC 60 LSPNVVRGPF TADEDEIIIA AQAKHGNRWA TIARLLPGRT GPAVEYRWCT MPARDRWTES 120 SDSAAREPTT SLPIGPHGDE EAPAASGGGG GDQRENEEMK AYLMSRRR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-23 | 14 | 114 | 6 | 106 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012480196.1 | 1e-33 | PREDICTED: transcription factor MYB44-like | ||||
Refseq | XP_016691648.1 | 1e-33 | PREDICTED: transcription factor MYB44-like | ||||
Refseq | XP_016691649.1 | 1e-33 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9SN12 | 4e-30 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0D2PYB5 | 2e-32 | A0A0D2PYB5_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8JSA3 | 2e-32 | A0A1U8JSA3_GOSHI; transcription factor MYB44-like | ||||
TrEMBL | A0A1U8JTP9 | 3e-32 | A0A1U8JTP9_GOSHI; transcription factor MYB44-like | ||||
STRING | Gorai.005G234900.1 | 4e-33 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09230.1 | 5e-27 | myb domain protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo6G0064900 |
Publications ? help Back to Top | |||
---|---|---|---|
|