PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo4G0080000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 234aa MW: 27145.8 Da PI: 9.2175 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.6 | 1.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng++KKA+ELS+LC+ae+a+i+fss+g+lyeyss Spipo4G0080000 9 KRIENTTNRQVTFCKRRNGLMKKAYELSILCEAEIALIVFSSRGRLYEYSS 59 79***********************************************96 PP | |||||||
2 | K-box | 104 | 1.9e-34 | 83 | 174 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +e ++++++qqe+ kL+++i++Lq+++Rhl+Ge L+sL++keL+qLe++Le+++ ++RskK+ell+++ie++qk+e el++e + Lr+kl+e Spipo4G0080000 83 TEVKTQQHYQQEAGKLRQQIQMLQNSNRHLMGEHLDSLNVKELKQLENRLERGIARVRSKKQELLFAEIEYMQKRELELENESMFLRSKLAE 174 667889***********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.6E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.109 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.05E-41 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 3.4E-31 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.5E-27 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.91 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLMK KAYELSILCE AEIALIVFSS RGRLYEYSSC 60 GNIYTTIDRY KKSHSASNPG AITEVKTQQH YQQEAGKLRQ QIQMLQNSNR HLMGEHLDSL 120 NVKELKQLEN RLERGIARVR SKKQELLFAE IEYMQKRELE LENESMFLRS KLAESERSHQ 180 LVQAGPEFEG LPGFDPRSYY HPLQMFDPSQ HYPTHQDQTA LQLGYEMKSN PSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-20 | 1 | 69 | 1 | 64 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010908080.1 | 1e-118 | MADS-box transcription factor 21 | ||||
Swissprot | F6I457 | 2e-98 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A1D1XDA0 | 1e-156 | A0A1D1XDA0_9ARAE; Floral homeotic protein AGAMOUS | ||||
STRING | XP_008781978.1 | 1e-117 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP649 | 37 | 144 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 6e-90 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo4G0080000 |