PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo4G0055100

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

MIKC_MADS

Protein Properties

Length: 152aa MW: 16975.7 Da PI: 10.5627

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo4G0055100	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	78.2	6e-25	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri++ +r v+fskRr g+lKKA EL vLCdaevav++fs++gkl +ss Spipo4G0055100 10 RIDDGARRMVSFSKRRSGLLKKARELAVLCDAEVAVVVFSPKGKLSHFSS 59 89*********************************************996 PP
2	K-box	21.6	9.3e-09	89	133	36	80
K-box 36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 +ll ++L + +++eL +Le++Le+ l+kiR +K+ ll+++ +l Spipo4G0055100 89 LRLLDDGLIEHDVNELTKLEDKLESELRKIRLRKTALLKDSGANL 133 5666778888899*************************9986665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	27.291	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.9E-32	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-24	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.33E-25	3	69	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.5E-23	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-24	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-24	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.2E-5	91	135	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 152 aa Download sequence Send to blast
MVRGKVKLQR IDDGARRMVS FSKRRSGLLK KARELAVLCD AEVAVVVFSP KGKLSHFSSQ 60 SRCPADDTWA LFFKREEKAP SLGGHKNLLR LLDDGLIEHD VNELTKLEDK LESELRKIRL 120 RKTALLKDSG ANLHDPLAQL NGQMGTDLRK S*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028072706.1	6e-29	MADS-box protein SOC1-like isoform X1
Swissprot	Q9XJ60	4e-26	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	A0A1D1XXJ4	7e-35	A0A1D1XXJ4_9ARAE; MADS-box transcription factor 56
STRING	cassava4.1_026051m	7e-27	(Manihot esculenta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	2e-28	AGAMOUS-like 14

Link Out ? help Back to Top
Phytozome	Spipo4G0055100

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]