PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0085100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TCP
Protein Properties Length: 238aa    MW: 25759.7 Da    PI: 9.2614
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0085100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP96.64.8e-3049120273
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                      g+kdrhsk+ T++g+RdRRvRls+++a++++dLqd+LG+ ++sk+++WLl +a+++i++l+ ++ ++ s+ 
  Spipo2G0085100  49 NGGKDRHSKVTTARGLRDRRVRLSVQTAIQLYDLQDRLGLNQPSKAVDWLLDAAQHEIDKLPPLQIPPGSSL 120
                     589*************************************************************66666443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.0E-2850112IPR005333Transcription factor, TCP
PROSITE profilePS5136929.70451109IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MIRNPREGAP STKQEEEAPP GDGNSGRGGS RPWPTALRDT RVVRGSRANG GKDRHSKVTT  60
ARGLRDRRVR LSVQTAIQLY DLQDRLGLNQ PSKAVDWLLD AAQHEIDKLP PLQIPPGSSL  120
YHNPPPPPQL VMPEKDDLQN AYSGYFLMEP PPPNPAGGNV AAQEEAQSYY RHPALQPTAA  180
PPPSLPLSLS HGSQLLLSMF SPYPAAAASS EYDPRHVNGS FEMGSSSGSQ GSRHHRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2056110155Putative transcription factor PCF6
5zkt_B2e-2056110155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006845879.11e-44transcription factor TCP5
RefseqXP_011623969.11e-44transcription factor TCP5
RefseqXP_020523844.11e-44transcription factor TCP5
RefseqXP_020523845.11e-44transcription factor TCP5
RefseqXP_020523846.11e-44transcription factor TCP5
RefseqXP_020523847.11e-44transcription factor TCP5
RefseqXP_020523848.11e-44transcription factor TCP5
STRINGERN075544e-44(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.16e-39TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5