PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo1G0052000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 238aa MW: 27279.5 Da PI: 5.0397 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.3 | 1.7e-54 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L k + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v Spipo1G0052000 6 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVS 99 79****************************.99**************84335556888************************************* PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++++g+kktLv+y+grap+g +t+Wvmheyrl Spipo1G0052000 100 C-QNRAIGMKKTLVYYRGRAPQGIRTNWVMHEYRL 133 *.8999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.24E-64 | 4 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.567 | 6 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.8E-30 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG LKIELDIIPE VDLYKCEPWE LAEKSFLPSR 60 DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSC QNRAIGMKKT LVYYRGRAPQ 120 GIRTNWVMHE YRLDDKDSED VVNIQDSYAL CRVFKKNVPI PDVEDQVQCS FPLAENSRGP 180 TNDYDNFSPD LAVGSSSGIE EDDKDNFWMQ FITEDAWCST LSSGEGAYDS PCVTSAT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-54 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-54 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-54 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-54 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swm_B | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swm_C | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swm_D | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_A | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_B | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_C | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_D | 4e-54 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
4dul_A | 4e-54 | 1 | 157 | 12 | 166 | NAC domain-containing protein 19 |
4dul_B | 4e-54 | 1 | 157 | 12 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00363 | DAP | Transfer from AT3G17730 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009392206.1 | 1e-141 | PREDICTED: NAC domain-containing protein 86 | ||||
Swissprot | A4VCM0 | 9e-87 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
TrEMBL | A0A1D1Y032 | 1e-153 | A0A1D1Y032_9ARAE; NAC domain-containing protein 74 | ||||
STRING | GSMUA_Achr3P13880_001 | 1e-141 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3713 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17730.1 | 1e-121 | NAC domain containing protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo1G0052000 |
Publications ? help Back to Top | |||
---|---|---|---|
|