PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo17G0034500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 250aa MW: 28437 Da PI: 7.7714 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 181.8 | 1.7e-56 | 5 | 132 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrFhPtdeelv +yL++k++g ++el evi+evd+yk+ePwdLp k + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatgkd++v Spipo17G0034500 5 LPPGFRFHPTDEELVYYYLRRKINGLQIEL-EVIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATRAGYWKATGKDRKV 97 79****************************.99**************95334455777************************************ PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vg+kktLv+y grap+g++tdWvmheyrl Spipo17G0034500 98 SY-QRRAVGMKKTLVYYMGRAPHGSRTDWVMHEYRL 132 *9.8999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.03E-64 | 3 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.935 | 5 | 155 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.0E-30 | 6 | 132 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MAPVLPPGFR FHPTDEELVY YYLRRKINGL QIELEVIPEV DLYKCEPWDL PEKSFLPSKD 60 LEWYFFSPRD RKYPNGSRTN RATRAGYWKA TGKDRKVSYQ RRAVGMKKTL VYYMGRAPHG 120 SRTDWVMHEY RLDERECEAA NGVQDAYALC RVFKKSAPGP KIMEHYGATY DGHLQWASGE 180 HCSAATTSCD ERADDLESCG FQALPTRPCA AAATRAETDA RDDGSWMQFL SDEALASSSF 240 AFVPSKSKR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-58 | 5 | 161 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-58 | 5 | 161 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-58 | 5 | 161 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-58 | 5 | 161 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-58 | 5 | 161 | 20 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-58 | 5 | 161 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-58 | 5 | 161 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00212 | DAP | Transfer from AT1G65910 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020083656.1 | 1e-127 | NAC domain-containing protein 86-like isoform X1 | ||||
Refseq | XP_020083657.1 | 1e-128 | NAC domain-containing protein 86-like isoform X2 | ||||
Refseq | XP_020248886.1 | 1e-128 | NAC domain-containing protein 86-like isoform X1 | ||||
Refseq | XP_020248888.1 | 1e-129 | NAC domain-containing protein 86-like isoform X2 | ||||
Swissprot | A4VCM0 | 4e-94 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
TrEMBL | A0A2H3X4N5 | 1e-124 | A0A2H3X4N5_PHODC; NAC domain-containing protein 86-like | ||||
TrEMBL | A0A2I0VCI8 | 1e-123 | A0A2I0VCI8_9ASPA; NAC domain-containing protein 78 | ||||
STRING | XP_008778272.1 | 1e-124 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6624 | 36 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65910.1 | 1e-101 | NAC domain containing protein 28 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo17G0034500 |
Publications ? help Back to Top | |||
---|---|---|---|
|