PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo15G0017300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 129aa MW: 14495.2 Da PI: 5.0893 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60.8 | 2.1e-19 | 37 | 90 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ eq+++Le+ Fe+++++ e++ +LAk+l+L+ rqV vWFqNrRa++k Spipo15G0017300 37 KKRRLSVEQVKALERNFEEENKLEPEKKVQLAKELDLQPRQVAVWFQNRRARWK 90 456899***********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 124.3 | 5.5e-40 | 36 | 125 | 1 | 90 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 ekkrrls eqvk+LE++Feee+kLepe+Kv+la+eL+lqprqvavWFqnrRAR+ktkqlE+dy+ Lk+ y++l+ + e+L+ ++++L +e Spipo15G0017300 36 EKKRRLSVEQVKALERNFEEENKLEPEKKVQLAKELDLQPRQVAVWFQNRRARWKTKQLERDYALLKSDYESLQLSLEALRVDNRALLAE 125 69**********************************************************************************999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-20 | 22 | 93 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.84E-20 | 24 | 94 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.767 | 32 | 92 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.5E-17 | 35 | 96 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.03E-16 | 37 | 93 | No hit | No description |
Pfam | PF00046 | 1.1E-16 | 37 | 90 | IPR001356 | Homeobox domain |
PROSITE pattern | PS00027 | 0 | 67 | 90 | IPR017970 | Homeobox, conserved site |
Pfam | PF02183 | 5.7E-11 | 92 | 126 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MIGAGDDEDY GQDLCRGDVA GSGTGDGDSS AGARGEKKRR LSVEQVKALE RNFEEENKLE 60 PEKKVQLAKE LDLQPRQVAV WFQNRRARWK TKQLERDYAL LKSDYESLQL SLEALRVDNR 120 ALLAEART* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 84 | 92 | RRARWKTKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00271 | DAP | Transfer from AT2G22430 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016740762.1 | 1e-43 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like | ||||
Swissprot | Q6K498 | 3e-41 | HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4 | ||||
Swissprot | Q9XH37 | 3e-41 | HOX4_ORYSI; Homeobox-leucine zipper protein HOX4 | ||||
TrEMBL | A0A1D1XW46 | 4e-49 | A0A1D1XW46_9ARAE; Homeobox-leucine zipper protein ATHB-16 | ||||
STRING | Gorai.003G041500.1 | 1e-42 | (Gossypium raimondii) | ||||
STRING | evm.model.supercontig_55.70 | 2e-42 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3009 | 34 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22430.1 | 1e-41 | homeobox protein 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo15G0017300 |
Publications ? help Back to Top | |||
---|---|---|---|
|