PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo11G0017500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 238aa MW: 27202.8 Da PI: 10.1401 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.9 | 4e-31 | 106 | 155 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLC+aeva+iifss+gklye+ Spipo11G0017500 106 KRIENKINRQVTFSKRRNGLLKKAYELSVLCEAEVALIIFSSRGKLYEFG 155 79**********************************************95 PP | |||||||
2 | K-box | 67.3 | 5.4e-23 | 173 | 237 | 4 | 68 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRsk 68 s+++ +++++s++qe++kLk+++++L r+qRhllGedL++Ls+keLqqLe+qLe+ l + R + Spipo11G0017500 173 SQNSTIVDHETQSWYQEVSKLKAKYDSLLRSQRHLLGEDLGPLSVKELQQLERQLESTLFQARRR 237 5566688999************************************************9998875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.403 | 98 | 158 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.6E-35 | 98 | 157 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 100 | 120 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.03E-42 | 101 | 175 | No hit | No description |
SuperFamily | SSF55455 | 1.28E-32 | 101 | 187 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-26 | 107 | 154 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 120 | 135 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 135 | 156 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-18 | 180 | 237 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.732 | 183 | 237 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MEGRRPFAWF GLFPRHFSFK PPAGRGGQKS SEFGFNPLLH PLTAHPPATQ SRPGNYQSEE 60 AEEERLTHRF LASPRDPPFQ DATFIIGLSW TGSGAGARWE GRVELKRIEN KINRQVTFSK 120 RRNGLLKKAY ELSVLCEAEV ALIIFSSRGK LYEFGSVGIA KTLERYQRCC YNSQNSTIVD 180 HETQSWYQEV SKLKAKYDSL LRSQRHLLGE DLGPLSVKEL QQLERQLEST LFQARRR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3kov_B | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3kov_I | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3kov_J | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3p57_A | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3p57_B | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3p57_C | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3p57_D | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3p57_I | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
3p57_J | 6e-19 | 102 | 180 | 4 | 85 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00315 | DAP | Transfer from AT2G45650 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020084133.1 | 1e-80 | MADS-box transcription factor 6-like | ||||
Swissprot | Q6EU39 | 6e-76 | MADS6_ORYSJ; MADS-box transcription factor 6 | ||||
TrEMBL | A0A2L0A429 | 8e-83 | A0A2L0A429_ANTAD; AGL6 | ||||
STRING | XP_008797646.1 | 1e-78 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4187 | 35 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-65 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo11G0017500 |